General Information

  • ID:  hor006490
  • Uniprot ID:  Q9R0R4
  • Protein name:  Apelin-31
  • Gene name:  Apln
  • Organism:  Mus musculus (Mouse)
  • Family:  Apelin family
  • Source:  Animal
  • Expression:  Not up-regulated following myocardial infarction (MI) (at protein level) . |Expressed in extraembryonic visceral endoderm and in the primitive streak at 6.5 and 7.5 dpc .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0031704 apelin receptor binding; GO:0042802 identical protein binding
  • GO BP:  GO:0001525 angiogenesis; GO:0002026 regulation of the force of heart contraction; GO:0003085 negative regulation of systemic arterial blood pressure; GO:0007165 signal transduction; GO:0007186 G protein-coupled receptor signaling pathway; GO:0007369 gastrulation; GO:0007631 feeding behavior; GO:0008284 positive regulation of cell population proliferation; GO:0010460 positive regulation of heart rate; GO:0010629 negative regulation of gene expression; GO:0031652 positive regulation of heat generation; GO:0040037 negative regulation of fibroblast growth factor receptor signaling pathway; GO:0042327 positive regulation of phosphorylation; GO:0042756 drinking behavior; GO:0045776 negative regulation of blood pressure; GO:0045823 positive regulation of heart contraction; GO:0045906 negative regulation of vasoconstriction; GO:0050878 regulation of body fluid levels; GO:0051461 positive regulation of corticotropin secretion; GO:0051466 positive regulation of corticotropin-releasing hormone secretion; GO:0060183 apelin receptor signaling pathway; GO:0060976 coronary vasculature development; GO:1902895 positive regulation of miRNA transcription; GO:1904022 positive regulation of G protein-coupled receptor internalization; GO:1904706 negative regulation of vascular associated smooth muscle cell proliferation; GO:1905564 positive regulation of vascular endothelial cell proliferation
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0048471 perinuclear region of cytoplasm

Sequence Information

  • Sequence:  TSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF
  • Length:  31(47-77)
  • Propeptide:  MNLRLCVQALLLLWLSLTAVCGVPLMLPPDGTGLEEGSMRYLVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF
  • Signal peptide:  MNLRLCVQALLLLWLSLTAVCG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endogenous ligand for the apelin receptor (APLNR). Drives internalization of APLNR (By similarity). Apelin-36 dissociates more hardly than (pyroglu)apelin-13 from APLNR (By similarity). Hormone involved in the regulation of cardiac precursor cell movement
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Aplnr
  • Target Unid:   Q9WV08
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9R0R4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006490_AF2.pdbhor006490_ESM.pdb

Physical Information

Mass: 414241 Formula: C157H253N59O38S
Absent amino acids: CDEINVY Common amino acids: R
pI: 13.28 Basic residues: 10
Polar residues: 9 Hydrophobic residues: 5
Hydrophobicity: -157.1 Boman Index: -12115
Half-Life / Aliphatic Index: 7.2 hour Aliphatic Index: 15.81
Instability Index: 8419.68 Extinction Coefficient cystines: 5500
Absorbance 280nm: 183.33

Literature

  • PubMed ID:  10525157
  • Title:  Apelin, the natural ligand of the orphan receptor APJ, is abundantly secreted in the colostrum.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  • PubMed ID:  11359874
  • Title:  Physiological role of a novel neuropeptide, apel
  • PubMed ID:  26611206
  • Title:  
  • PubMed ID:  28854362
  • Title:  
  • PubMed ID:  28890073
  • Title: