General Information

  • ID:  hor006485
  • Uniprot ID:  Q9QY05
  • Protein name:  Insulin-like peptide INSL6 B chain
  • Gene name:  Insl6
  • Organism:  Mus musculus (Mouse)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0006915 apoptotic process; GO:0007165 signal transduction; GO:0007283 spermatogenesis; GO:0007286 spermatid development; GO:0008584 male gonad development; GO:0009566 fertilization; GO:0030317 flagellated sperm motility; GO:0035234 ectopic germ cell programmed cell death; GO:0043066 negative regulation of apoptotic process; GO:0051093 negative regulation of developmental process; GO:2000242 negative regulation of reproductive process
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  EEEESRPRKLCGRHLLIEVIKLCGQSDWS
  • Length:  29(23-51)
  • Propeptide:  MKQLCCSCLLWLGLLLTPFSREEEEESRPRKLCGRHLLIEVIKLCGQSDWSRFEMEEQSPMTQFFPHYSRKGKAFNPHPSSSAWRRFTNPVPAGVSQKKGTHTWEPQSLPDYQFEKTELLPKARVFSYHSGKPYVKSVQLQKKSTNKMNTFRSLFWGNHSQRKRRGFADKCCVIGCTKEEMAVACLPFVDF
  • Signal peptide:  MKQLCCSCLLWLGLLLTPFSRE
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May have a role in sperm development and fertilization.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Rxfp4
  • Target Unid:  Q7TQP4
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9QY05-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006485_AF2.pdbhor006485_ESM.pdb

Physical Information

Mass: 391151 Formula: C146H240N44O46S2
Absent amino acids: AFMNTY Common amino acids: E
pI: 5.71 Basic residues: 6
Polar residues: 7 Hydrophobic residues: 8
Hydrophobicity: -73.45 Boman Index: -7870
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 90.69
Instability Index: 8886.55 Extinction Coefficient cystines: 5625
Absorbance 280nm: 200.89

Literature

  • PubMed ID:  10614671
  • Title:  Identification, chromosomal mapping, and partial characterization of mouse InsI6: a new member of the insulin family.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).