General Information

  • ID:  hor006484
  • Uniprot ID:  Q9PUR1
  • Protein name:  Glucagon-like peptide 2-I
  • Gene name:  gcg1
  • Organism:  Petromyzon marinus (Sea lamprey)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Petromyzon (genus), Petromyzontidae (family), Petromyzontiformes (order), Hyperoartia (class), Cyclostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HAEDVNALLDRTMAKTFIEWLEKQNSNDQTD
  • Length:  31(130-160)
  • Propeptide:  MSDPGFLAAPVLLLLLVSLASASLEQAASRDDDSAERPLSKRHSEGTFTSDYSKYLENKQAKDFVRWLMNAKRGGSELQRRHADGTFTNDMTSYLDAKAARDFVSWLARSDKSRRDGGDHLAENSEDKRHAEDVNALLDRTMAKTFIEWLEKQNSNDQTD
  • Signal peptide:  MSDPGFLAAPVLLLLLVSLASA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9PUR1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006484_AF2.pdbhor006484_ESM.pdb

Physical Information

Mass: 416926 Formula: C155H242N44O55S
Absent amino acids: CGPY Common amino acids: D
pI: 4.17 Basic residues: 4
Polar residues: 7 Hydrophobic residues: 10
Hydrophobicity: -100.32 Boman Index: -9129
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 69.35
Instability Index: 4207.42 Extinction Coefficient cystines: 5500
Absorbance 280nm: 183.33

Literature

  • PubMed ID:  10555286
  • Title:  Lamprey proglucagon and the origin of glucagon-like peptides.
  • PubMed ID:  8405897
  • Title:  Primary structures of glucagon and glucagon-like peptide isolated from the intestine of the parasitic phase lamprey Petromyzon marinus.