General Information

  • ID:  hor006482
  • Uniprot ID:  Q9GMB7
  • Protein name:  Osteostatin
  • Gene name:  PTHLH
  • Organism:  Equus caballus (Horse)
  • Family:  Parathyroid hormone family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Equus (genus), Equidae (family), Perissodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0002076 osteoblast development; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0030282 bone mineralization; GO:0032330 regulation of chondrocyte differentiation
  • GO CC:  GO:0005576 extracellular region; GO:0005634 nucleus; GO:0005737 cytoplasm

Sequence Information

  • Sequence:  TRSAWLNSEVAESGLDGDHLSDFSTTSPELYLR
  • Length:  33(103-135)
  • Propeptide:  HQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKLEPYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLNSEVAESGLDGDHLSDFSTTSPELYLRRH
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interaction
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  PTH1R
  • Target Unid:   F6Z5Y6
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9GMB7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006482_AF2.pdbhor006482_ESM.pdb

Physical Information

Mass: 422585 Formula: C158H241N43O57
Absent amino acids: CIKMQ Common amino acids: S
pI: 4.07 Basic residues: 3
Polar residues: 13 Hydrophobic residues: 10
Hydrophobicity: -56.36 Boman Index: -7653
Half-Life / Aliphatic Index: 7.2 hour Aliphatic Index: 73.94
Instability Index: 6028.48 Extinction Coefficient cystines: 6990
Absorbance 280nm: 218.44

Literature

  • PubMed ID:  NA
  • Title:  NA