HORDB

General Information

ID: hor006479
Uniprot ID: Q9CR53
Protein name: Neuromedin-B-32
Gene name: Nmb
Organism: Mus musculus (Mouse)
Family: Bombesin/neuromedin-B/ranatensin family
Source: Animal
Expression: Up-regulated in lung tissue in response to infection with influenza A virus. |During osteoclast development, expression increases as the cells differentiate with high expression levels in mature osteoclasts (at protein level). |In the hindbrain, expressed
Disease: NA
Comments: NA
Taxonomy: Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005184 neuropeptide hormone activity; GO:0031710 neuromedin B receptor binding
GO BP: GO:0002376 immune system process; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0008284 positive regulation of cell population proliferation; GO:0032715 negative regulation of interleukin-6 production; GO:0032727 positive regulation of interferon-alpha production; GO:0045087 innate immune response; GO:0046887 positive regulation of hormone secretion; GO:0046888 negative regulation of hormone secretion; GO:0050482 arachidonic acid secretion; GO:0090290 positive regulation of osteoclast proliferation; GO:0140374 antiviral innate immune response; GO:0160023 sneeze reflex; GO:0160024 Leydig cell proliferation; GO:0160025 sensory perception of itch; GO:1903942 positive regulation of respiratory gaseous exchange; GO:2000845 positive regulation of testosterone secretion
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0042995 cell projection; GO:0043005 neuron projection

Sequence Information

Sequence: APFNWDLPEPRSRASKIRVHPRGNLWATGHFM
Length: 32(25-56)
Propeptide: MTRQAGSSWLLRGLLLFALFASGVAPFNWDLPEPRSRASKIRVHPRGNLWATGHFMGKKSLEPPSLSLVGTAPPNTPRDQRLQLSHDLLRILLRKKALGMNFSGPAPPIQYRRLLEPLLQK
Signal peptide: MTRQAGSSWLLRGLLLFALFASGV
Modification: T32 Methionine amide
Glycosylation: NA
Mutagenesis: NA

Activity

Function: Stimulates smooth muscle contraction (By similarity). Induces sighing by acting directly on the pre-Botzinger complex, a cluster of several thousand neurons in the ventrolateral medulla responsible for inspiration during respiratory activity (PubMed:26855
Mechanism: NA
Cross BBB: NA
Target: Nmbr
Target Unid: O54799
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-Q9CR53-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006479_AF2.pdb

hor006479_ESM.pdb

Physical Information

Mass:	429839	Formula:	C170H255N53O42S
Absent amino acids:	CQY	Common amino acids:	PR
pI:	12.05	Basic residues:	7
Polar residues:	7	Hydrophobic residues:	11
Hydrophobicity:	-76.25	Boman Index:	-7365
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	55
Instability Index:	3894.06	Extinction Coefficient cystines:	11000
Absorbance 280nm:	354.84

Literature

PubMed ID: 16141072
Title: The transcriptional landscape of the mammalian genome.
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
PubMed ID: 26855425
Title: The peptidergic control circuit for sighing.
PubMed ID: 28780306
Title: Neuromedin B and its receptor silencing sup
PubMed ID: 30734045
Title:
PubMed ID: 31601264
Title:
PubMed ID: 34133943
Title: