General Information

  • ID:  hor006479
  • Uniprot ID:  Q9CR53
  • Protein name:  Neuromedin-B-32
  • Gene name:  Nmb
  • Organism:  Mus musculus (Mouse)
  • Family:  Bombesin/neuromedin-B/ranatensin family
  • Source:  Animal
  • Expression:  Up-regulated in lung tissue in response to infection with influenza A virus. |During osteoclast development, expression increases as the cells differentiate with high expression levels in mature osteoclasts (at protein level). |In the hindbrain, expressed
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0031710 neuromedin B receptor binding
  • GO BP:  GO:0002376 immune system process; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0008284 positive regulation of cell population proliferation; GO:0032715 negative regulation of interleukin-6 production; GO:0032727 positive regulation of interferon-alpha production; GO:0045087 innate immune response; GO:0046887 positive regulation of hormone secretion; GO:0046888 negative regulation of hormone secretion; GO:0050482 arachidonic acid secretion; GO:0090290 positive regulation of osteoclast proliferation; GO:0140374 antiviral innate immune response; GO:0160023 sneeze reflex; GO:0160024 Leydig cell proliferation; GO:0160025 sensory perception of itch; GO:1903942 positive regulation of respiratory gaseous exchange; GO:2000845 positive regulation of testosterone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0042995 cell projection; GO:0043005 neuron projection

Sequence Information

  • Sequence:  APFNWDLPEPRSRASKIRVHPRGNLWATGHFM
  • Length:  32(25-56)
  • Propeptide:  MTRQAGSSWLLRGLLLFALFASGVAPFNWDLPEPRSRASKIRVHPRGNLWATGHFMGKKSLEPPSLSLVGTAPPNTPRDQRLQLSHDLLRILLRKKALGMNFSGPAPPIQYRRLLEPLLQK
  • Signal peptide:  MTRQAGSSWLLRGLLLFALFASGV
  • Modification:  T32 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates smooth muscle contraction (By similarity). Induces sighing by acting directly on the pre-Botzinger complex, a cluster of several thousand neurons in the ventrolateral medulla responsible for inspiration during respiratory activity (PubMed:26855
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Nmbr
  • Target Unid:   O54799
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9CR53-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006479_AF2.pdbhor006479_ESM.pdb

Physical Information

Mass: 429839 Formula: C170H255N53O42S
Absent amino acids: CQY Common amino acids: PR
pI: 12.05 Basic residues: 7
Polar residues: 7 Hydrophobic residues: 11
Hydrophobicity: -76.25 Boman Index: -7365
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 55
Instability Index: 3894.06 Extinction Coefficient cystines: 11000
Absorbance 280nm: 354.84

Literature

  • PubMed ID:  16141072
  • Title:  The transcriptional landscape of the mammalian genome.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  • PubMed ID:  26855425
  • Title:  The peptidergic control circuit for sighing.
  • PubMed ID:  28780306
  • Title:  Neuromedin B and its receptor silencing sup
  • PubMed ID:  30734045
  • Title:  
  • PubMed ID:  31601264
  • Title:  
  • PubMed ID:  34133943
  • Title: