General Information

  • ID:  hor006472
  • Uniprot ID:  Q8I7X1
  • Protein name:  Androgenic gland hormone B chain
  • Gene name:  AGH
  • Organism:  Porcellio scaber (Common rough woodlouse) (Oniscus granulatus)
  • Family:  NA
  • Source:  Animal
  • Expression:  Androgenic gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Porcellio (genus), Porcellionidae (family), Crinocheta , Oniscidea (suborder), Isopoda (order), Peracarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007283 spermatogenesis; GO:0007548 sex differentiation; GO:0030154 cell differentiation
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YQVIGMKSDVICADIRFTVHCICNELGLFPTSRLSKPCPWPNRG
  • Length:  44(22-65)
  • Propeptide:  MKGLLFIVSLLCLTLHQRVWAYQVIGMKSDVICADIRFTVHCICNELGLFPTSRLSKPCPWPNRGRRSADDEDYLFEEDEDDEFFHPRALSPPAAKSGDERLEDEVSFHSRSKRDIAFHEECCNIRTEHKCNKTTVELYCRRYTR
  • Signal peptide:  MKGLLFIVSLLCLTLHQRVWA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Controls sex differentiation and the formation of male appendages, spermatogenesis, pigmentation, and male specific behavior.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  21-38
  • Structure ID:  AF-Q8I7X1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006472_AF2.pdbhor006472_ESM.pdb

Physical Information

Mass: 573402 Formula: C220H347N61O60S5
Absent amino acids: Common amino acids: CIP
pI: 8.34 Basic residues: 6
Polar residues: 15 Hydrophobic residues: 14
Hydrophobicity: 5 Boman Index: -5212
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 84.09
Instability Index: 1325 Extinction Coefficient cystines: 7240
Absorbance 280nm: 168.37

Literature

  • PubMed ID:  15081839
  • Title:  The glycosylated androgenic hormone of the terrestrial isopod Porcellio scaber (Crustacea).
  • PubMed ID:  12560604
  • Title:  Molecular cloning and expression analysis of cDNAs encoding androgenic gland hormone precursors from two porcellionidae species, Porcellio scaber and P. dilatatus