General Information

  • ID:  hor006460
  • Uniprot ID:  Q5CZK3
  • Protein name:  Insulin-like 3 B chain
  • Gene name:  INSL3
  • Organism:  Pan troglodytes (Chimpanzee)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Pan (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  LGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEA
  • Length:  35(21-55)
  • Propeptide:  MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPAAGGDREWLQWLERRHLLHGLVANSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY
  • Signal peptide:  MDPRLPAWALVLLGPALVFA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Seems to play a role in testicular function. May be a trophic hormone with a role in testicular descent in fetal life. Is a ligand for LGR8 receptor (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RXFP2, RXFP1
  • Target Unid:   H2Q7E1, H2R4E6
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q5CZK3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006460_AF2.pdbhor006460_ESM.pdb

Physical Information

Mass: 446613 Formula: C169H269N53O45S3
Absent amino acids: DINQY Common amino acids: GPR
pI: 8.83 Basic residues: 7
Polar residues: 9 Hydrophobic residues: 11
Hydrophobicity: -30.86 Boman Index: -5723
Half-Life / Aliphatic Index: 5.5 hour Aliphatic Index: 66.86
Instability Index: 4138.29 Extinction Coefficient cystines: 5625
Absorbance 280nm: 165.44

Literature

  • PubMed ID:  16136131
  • Title:  Initial sequence of the chimpanzee genome and comparison with the human genome.
  • PubMed ID:  15707501
  • Title:  Evolution of the relaxin-like peptide family.