General Information

  • ID:  hor006446
  • Uniprot ID:  P79695
  • Protein name:  Glucagon-like peptide
  • Gene name:  gcg
  • Organism:  Carassius auratus (Goldfish)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Carassius (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi , Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HAEGTYTSDISSFLRDQAAQNFVAWLKSGQPKQE
  • Length:  34(88-121)
  • Propeptide:  MKGAQYLAGLLLLLFVQNSICVPLQDYHTSTETVEGLLARGQGFTTAKRHSEGTFSNDYSKYLETRRAQDFVEWLMNSKSNGGSAKRHAEGTYTSDISSFLRDQAAQNFVAWLKSGQPKQE
  • Signal peptide:  MKGAQYLAGLLLLLFVQNSIC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Glucagon]: Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P79695-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006446_AF2.pdbhor006446_ESM.pdb

Physical Information

Mass: 439994 Formula: C168H253N47O55
Absent amino acids: CM Common amino acids: AQS
pI: 5.59 Basic residues: 4
Polar residues: 10 Hydrophobic residues: 11
Hydrophobicity: -79.71 Boman Index: -7321
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 54.71
Instability Index: 3104.71 Extinction Coefficient cystines: 6990
Absorbance 280nm: 211.82

Literature

  • PubMed ID:  NA
  • Title:  NA