General Information

  • ID:  hor006439
  • Uniprot ID:  P58073
  • Protein name:  Osteostatin
  • Gene name:  PTHLH
  • Organism:  Bos taurus (Bovine)
  • Family:  Parathyroid hormone family
  • Source:  Animal
  • Expression:  Expressed in the mammary gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0001501 skeletal system development; GO:0002076 osteoblast development; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0010468 regulation of gene expression; GO:0030282 bone mineralization; GO:0032330 regulation of chondrocyte differentiation; GO:0032331 negative regulation of chondrocyte differentiation; GO:0061182 negative regulation of chondrocyte development
  • GO CC:  GO:0005576 extracellular region; GO:0005634 nucleus; GO:0005654 nucleoplasm; GO:0005737 cytoplasm; GO:0005794 Golgi apparatus; GO:0005829 cytosol

Sequence Information

  • Sequence:  TRSAWLTSYVAGTGLEEDYLSDISATSLELNSR
  • Length:  33(143-175)
  • Propeptide:  MLWRLVQQWSVAVFLLSYSVPSCGRSVEELGRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPAPNTKNHPVRFGSDDEGKYLTQETNKVETYKEQPLKTPGKKKKSKPGKRKEQEKKKRRTRSAWLTSYVAGTGLEEDYLSDISATSLELNSRRH
  • Signal peptide:  MLWRLVQQWSVAVFLLSYSVPSCG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interaction
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  PTH1R
  • Target Unid:  Q1LZF7
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P58073-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006439_AF2.pdbhor006439_ESM.pdb

Physical Information

Mass: 417785 Formula: C156H245N41O57
Absent amino acids: CFHKMPQ Common amino acids: S
pI: 3.95 Basic residues: 2
Polar residues: 15 Hydrophobic residues: 11
Hydrophobicity: -26.67 Boman Index: -6211
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 88.79
Instability Index: 4288.48 Extinction Coefficient cystines: 8480
Absorbance 280nm: 265

Literature

  • PubMed ID:  9584841
  • Title:  Cloning of bovine parathyroid hormone-related protein (PTHrP) cDNA and expression of PTHrP mRNA in the bovine mammary gland.