General Information

  • ID:  hor006429
  • Uniprot ID:  P51461
  • Protein name:  Insulin-like 3 B chain
  • Gene name:  INSL3
  • Organism:  Sus scrofa (Pig)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  Expressed exclusively in prenatal and postnatal Leydig cells.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0002020 protease binding; GO:0005179 hormone activity
  • GO BP:  GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway; GO:0010634 positive regulation of epithelial cell migration; GO:0090303 positive regulation of wound healing
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QEAPEKLCGHHFVRALVRLCGGPRWSPEDG
  • Length:  30(27-56)
  • Propeptide:  MDPHPLTWALVLLGPALALSRAPAPAQEAPEKLCGHHFVRALVRLCGGPRWSPEDGRAVAGGDRELLQWLEGQHLFHGLMASGDPMLVLAPQPPPQASGHHHHRRAAATNPARHCCLSGCTRQDLLTLCPH
  • Signal peptide:  MDPHPLTWALVLLGPALALSRAPAPA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Seems to play a role in testicular function. May be a trophic hormone with a role in testicular descent in fetal life. Is a ligand for LGR8 receptor (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RXFP2, RXFP1
  • Target Unid:  I3LLS2, A0A5G2QC39
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P51461-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006429_AF2.pdbhor006429_ESM.pdb

Physical Information

Mass: 386326 Formula: C146H226N46O41S2
Absent amino acids: IMNTY Common amino acids: G
pI: 7.42 Basic residues: 6
Polar residues: 7 Hydrophobic residues: 9
Hydrophobicity: -60.67 Boman Index: -5963
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 65
Instability Index: 6956.67 Extinction Coefficient cystines: 5625
Absorbance 280nm: 193.97

Literature

  • PubMed ID:  8253799
  • Title:  Cloning of a cDNA for a novel insulin-like peptide of the testicular Leydig cells.
  • PubMed ID:  8020942
  • Title:  Structural organization of the porcine and human genes coding for a Leydig cell-specific insulin-like peptide (LEY I-L) and chromosomal localization of the human gene (INS