General Information

  • ID:  hor006417
  • Uniprot ID:  P27596
  • Protein name:  Atrial natriuretic factor
  • Gene name:  NPPA
  • Organism:  Cavia porcellus (Guinea pig)
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  Adult.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0003008 system process; GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007565 female pregnancy; GO:0008217 regulation of blood pressure; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0042995 cell projection; GO:0043204 perikaryon

Sequence Information

  • Sequence:  SLRRSSCFGGRMDRIGAQSSLGCNSFRY
  • Length:  28(99-126)
  • Propeptide:  NPMYNVVSNADLVDFKNLLDHLEEKMPLEDEVVLPQVASEQNEEAGAVLSALPEVPSWPGEAGPAQREGGALGRGPWDSSDRSAPLKSKLRALLDAPRSLRRSSCFGGRMDRIGAQSSLGCNSFRYRR
  • Signal peptide:  NA
  • Modification:  T6 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Atrial natriuretic peptide]: Hormone that plays a key role in mediating cardio-renal homeostasis, and is involved in vascular remodeling and regulating energy metabolism. Acts by specifically binding and stimulating NPR1 to produce cGMP, which in turn ac
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPR1, NPR2
  • Target Unid:   H0W391, H0UTW0
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45861
  • Structure ID:  AF-P27596-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006417_AF2.pdbhor006417_ESM.pdb

Physical Information

Mass: 359426 Formula: C128H207N45O40S3
Absent amino acids: EHKPTVW Common amino acids: S
pI: 10.95 Basic residues: 5
Polar residues: 14 Hydrophobic residues: 6
Hydrophobicity: -51.07 Boman Index: -8484
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 45.36
Instability Index: 8943.21 Extinction Coefficient cystines: 1615
Absorbance 280nm: 59.81

Literature

  • PubMed ID:  NA
  • Title:  NA