General Information

  • ID:  hor006403
  • Uniprot ID:  P17251
  • Protein name:  Osteostatin
  • Gene name:  PTHLH
  • Organism:  Gallus gallus (Chicken)
  • Family:  Parathyroid hormone family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria , Theropoda , Saurischia , Dinosauria , Archosauria , Archelosauria , Sauria , Sauropsida , Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0002076 osteoblast development; GO:0003420 regulation of growth plate cartilage chondrocyte proliferation; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0030282 bone mineralization; GO:0032330 regulation of chondrocyte differentiation; GO:1902733 regulation of growth plate cartilage chondrocyte differentiation; GO:1903042 negative regulation of chondrocyte hypertrophy
  • GO CC:  GO:0005576 extracellular region; GO:0005634 nucleus; GO:0005737 cytoplasm

Sequence Information

  • Sequence:  RSAWLNSGMYGSNVTESPVLDNSVTTHNHILR
  • Length:  32
  • Propeptide:  MMFTKLFQQWSFAVFLLSYSVPSYGRSVEGISRRLKRAVSEHQLLHDKGKSIQDLRRRIFLQNLIEGVNTAEIRATSEVSPNPKPATNTKNYPVRFGSEDEGRYLTQETNKSQTYKEQPLKVSGKKKKAKPGKRKEQEKKKRRARSAWLNSGMYGSNVTESPVLDNSVTTHNHILR
  • Signal peptide:  MMFTKLFQQWSFAVFLLSYSVPSYG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  PTH1R
  • Target Unid:  C7S302
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P17251-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006403_AF2.pdbhor006403_ESM.pdb

Physical Information

Mass: 411002 Formula: C152H239N47O50S
Absent amino acids: CFKQ Common amino acids: S
pI: 7.71 Basic residues: 4
Polar residues: 15 Hydrophobic residues: 9
Hydrophobicity: -46.56 Boman Index: -6593
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 79.06
Instability Index: 9110.94 Extinction Coefficient cystines: 6990
Absorbance 280nm: 225.48

Literature

  • PubMed ID:  2349111
  • Title:  Nucleotide sequence of a parathyroid hormone-related peptide expressed by the 10 day chicken embryo.
  • PubMed ID:  10366729
  • Title:  Structure study of osteostatin PTHrP[Thr107](107-139).