General Information

  • ID:  hor006401
  • Uniprot ID:  P12272
  • Protein name:  PTHrP
  • Gene name:  PTHLH
  • Organism:  Homo sapiens (Human)
  • Family:  Parathyroid hormone family
  • Source:  Human
  • Expression:  Ubiquitous. Also expressed in the mammary gland.
  • Disease:  Diseases associated with PTHLH include Brachydactyly, Type E2 and Brachydactyly, Type E1.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0001501 skeletal system development; GO:0002076 osteoblast development; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007267 cell-cell signaling; GO:0007565 female pregnancy; GO:0008284 positive regulation of cell population proliferation; GO:0008285 negative regulation of cell population proliferation; GO:0008544 epidermis development; GO:0010468 regulation of gene expression; GO:0030282 bone mineralization; GO:0032330 regulation of chondrocyte differentiation; GO:0032331 negative regulation of chondrocyte differentiation; GO:0046058 cAMP metabolic process; GO:0061182 negative regulation of chondrocyte development
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005634 nucleus; GO:0005654 nucleoplasm; GO:0005737 cytoplasm; GO:0005794 Golgi apparatus; GO:0005829 cytosol

Sequence Information

  • Sequence:  ATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKP
  • Length:  57(74-130)
  • Propeptide:  MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH
  • Signal peptide:  MQRRLVQQWSVAVFLLSYAVPSCG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interaction
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  PTH1R
  • Target Unid:   Q03431
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P12272-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006401_AF2.pdbhor006401_ESM.pdb

Physical Information

Mass: 735505 Formula: C276H447N81O91
Absent amino acids: CIMW Common amino acids: K
pI: 10.37 Basic residues: 13
Polar residues: 21 Hydrophobic residues: 7
Hydrophobicity: -167.54 Boman Index: -18132
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 30.7
Instability Index: 3214.21 Extinction Coefficient cystines: 2980
Absorbance 280nm: 53.21

Literature

  • PubMed ID:  3616618
  • Title:  A parathyroid hormone-related protein implicated in malignant hypercalcemia: cloning and expression.
  • PubMed ID:  2829195
  • Title:  Identification of a cDNA encoding a parathyroid hormone-like peptide from a human tumor associated with humoral hypercalcemia of malignancy.
  • PubMed ID:  2708388
  • Title:  Characteriz
  • PubMed ID:  3290897
  • Title:  
  • PubMed ID:  15489334
  • Title:  
  • PubMed ID:  2744490
  • Title:  
  • PubMed ID:  2885845
  • Title:  
  • PubMed ID:  2928340
  • Title:  
  • PubMed ID:  1915066
  • Title:  
  • PubMed ID:  1954916
  • Title:  
  • PubMed ID:  9144344
  • Title:  
  • PubMed ID:  9048639
  • Title:  
  • PubMed ID:  12852260
  • Title:  
  • PubMed ID:  11401507
  • Title:  
  • PubMed ID:  12538599
  • Title:  
  • PubMed ID:  20637541
  • Title:  
  • PubMed ID:  10050767
  • Title:  
  • PubMed ID:  12504010
  • Title:  
  • PubMed ID:  19674967
  • Title:  
  • PubMed ID:  16959974
  • Title:  
  • PubMed ID:  20170896
  • Title: