HORDB

General Information

ID: hor006398
Uniprot ID: P11030
Protein name: Triakontatetraneuropeptide
Gene name: Dbi
Organism: Rattus norvegicus (Rat)
Family: ACBP family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0000062 fatty-acyl-CoA binding; GO:0005515 protein binding; GO:0008289 lipid binding; GO:0030156 benzodiazepine receptor binding; GO:0036042 long-chain fatty acyl-CoA binding; GO:0042802 identical protein binding
GO BP: GO:0001662 behavioral fear response; GO:0001942 hair follicle development; GO:0006631 fatty acid metabolic process; GO:0006637 acyl-CoA metabolic process; GO:0006641 triglyceride metabolic process; GO:0006694 steroid biosynthetic process; GO:0007611 learning or memory; GO:0014009 glial cell proliferation; GO:0021670 lateral ventricle development; GO:0031670 cellular response to nutrient; GO:0031999 negative regulation of fatty acid beta-oxidation; GO:0032228 regulation of synaptic transmission, GABAergic; GO:0036151 phosphatidylcholine acyl-chain remodeling; GO:0043588 skin development; GO:0046889 positive regulation of lipid biosynthetic process; GO:0051281 positive regulation of release of sequestered calcium ion into cytosol; GO:0060291 long-term synaptic potentiation; GO:1903060 negative regulation of protein lipidation; GO:2001140 positive regulation of phospholipid transport
GO CC: GO:0005615 extracellular space; GO:0005783 endoplasmic reticulum; GO:0005794 Golgi apparatus; GO:0008021 synaptic vesicle; GO:0032994 protein-lipid complex; GO:0043292 contractile fiber

Sequence Information

Sequence: TQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLK
Length: 34
Propeptide: MSQADFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKENAMKTYVEKVEELKKKYGI
Signal peptide: NA
Modification: T12 Phosphotyrosine;T34 N6-acetyllysine
Glycosylation: NA
Mutagenesis: NA

Activity

Function: Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-P11030-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006398_AF2.pdb

hor006398_ESM.pdb

Physical Information

Mass:	446915	Formula:	C172H268N44O56S
Absent amino acids:	CW	Common amino acids:	DLT
pI:	4.32	Basic residues:	4
Polar residues:	9	Hydrophobic residues:	10
Hydrophobicity:	-54.41	Boman Index:	-6604
Half-Life:	7.2 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	77.35
Instability Index:	1819.12	Extinction Coefficient cystines:	1490
Absorbance 280nm:	45.15

Literature

PubMed ID: 3463960
Title: Putative diazepam binding inhibitor peptide: cDNA clones from rat.
PubMed ID: 2821429
Title: Molecular biology of diazepam binding inhibitor.
PubMed ID: 1469708
Title: Acyl-CoA-binding protein/diazepam-binding inhibitor gene and pseudogenes. A typical housekeeping gene family.
PubMed ID: 8964506
Title: Structure of the rat gene encoding the multifunctional acyl-CoA-binding protein: conservation of intron 1 sequences in rodents and man. Addendum.
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
PubMed ID: 7690962
Title: Cloning and tissue-specific functional characterization of the promoter of the rat diazepam binding inhibitor, a peptide with multiple biological actions.
PubMed ID: 2803267
Title: Acyl-CoA-binding protein in the rat. Purification, binding characteristics, tissue concentrations and amino acid sequence.
PubMed ID: 2769267
Title: Isolation and characterization of a rat brain triakontatetraneuropeptide, a posttranslational product of diazepam binding inhibitor: specific action at the Ro 5-4864 recognition site.