General Information

  • ID:  hor006398
  • Uniprot ID:  P11030
  • Protein name:  Triakontatetraneuropeptide
  • Gene name:  Dbi
  • Organism:  Rattus norvegicus (Rat)
  • Family:  ACBP family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0000062 fatty-acyl-CoA binding; GO:0005515 protein binding; GO:0008289 lipid binding; GO:0030156 benzodiazepine receptor binding; GO:0036042 long-chain fatty acyl-CoA binding; GO:0042802 identical protein binding
  • GO BP:  GO:0001662 behavioral fear response; GO:0001942 hair follicle development; GO:0006631 fatty acid metabolic process; GO:0006637 acyl-CoA metabolic process; GO:0006641 triglyceride metabolic process; GO:0006694 steroid biosynthetic process; GO:0007611 learning or memory; GO:0014009 glial cell proliferation; GO:0021670 lateral ventricle development; GO:0031670 cellular response to nutrient; GO:0031999 negative regulation of fatty acid beta-oxidation; GO:0032228 regulation of synaptic transmission, GABAergic; GO:0036151 phosphatidylcholine acyl-chain remodeling; GO:0043588 skin development; GO:0046889 positive regulation of lipid biosynthetic process; GO:0051281 positive regulation of release of sequestered calcium ion into cytosol; GO:0060291 long-term synaptic potentiation; GO:1903060 negative regulation of protein lipidation; GO:2001140 positive regulation of phospholipid transport
  • GO CC:  GO:0005615 extracellular space; GO:0005783 endoplasmic reticulum; GO:0005794 Golgi apparatus; GO:0008021 synaptic vesicle; GO:0032994 protein-lipid complex; GO:0043292 contractile fiber

Sequence Information

  • Sequence:  TQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLK
  • Length:  34
  • Propeptide:  MSQADFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKENAMKTYVEKVEELKKKYGI
  • Signal peptide:  NA
  • Modification:  T12 Phosphotyrosine;T34 N6-acetyllysine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P11030-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006398_AF2.pdbhor006398_ESM.pdb

Physical Information

Mass: 446915 Formula: C172H268N44O56S
Absent amino acids: CW Common amino acids: DLT
pI: 4.32 Basic residues: 4
Polar residues: 9 Hydrophobic residues: 10
Hydrophobicity: -54.41 Boman Index: -6604
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 77.35
Instability Index: 1819.12 Extinction Coefficient cystines: 1490
Absorbance 280nm: 45.15

Literature

  • PubMed ID:  3463960
  • Title:  Putative diazepam binding inhibitor peptide: cDNA clones from rat.
  • PubMed ID:  2821429
  • Title:  Molecular biology of diazepam binding inhibitor.
  • PubMed ID:  1469708
  • Title:  Acyl-CoA-binding protein/diazepam-binding inhibitor gene and pseudogenes. A typical housekeeping gene family.
  • PubMed ID:  8964506
  • Title:  Structure of the rat gene encoding the multifunctional acyl-CoA-binding protein: conservation of intron 1 sequences in rodents and man. Addendum.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  • PubMed ID:  7690962
  • Title:  Cloning and tissue-specific functional characterization of the promoter of the rat diazepam binding inhibitor, a peptide with multiple biological actions.
  • PubMed ID:  2803267
  • Title:  Acyl-CoA-binding protein in the rat. Purification, binding characteristics, tissue concentrations and amino acid sequence.
  • PubMed ID:  2769267
  • Title:  Isolation and characterization of a rat brain triakontatetraneuropeptide, a posttranslational product of diazepam binding inhibitor: specific action at the Ro 5-4864 recognition site.