General Information

  • ID:  hor006388
  • Uniprot ID:  P07500
  • Protein name:  Atrial natriuretic factor
  • Gene name:  NPPA
  • Organism:  Oryctolagus cuniculus (Rabbit)
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Oryctolagus (genus), Leporidae (family), Lagomorpha (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0003008 system process; GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007565 female pregnancy; GO:0008217 regulation of blood pressure; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0042995 cell projection; GO:0043204 perikaryon

Sequence Information

  • Sequence:  SLRRSSCFGGRIDRIGAQSGLGCNSFRY
  • Length:  28(124-151)
  • Propeptide:  MGPFSTITVSFLFCLAFWHPDQIGANPVYNAMSNADLMDFKNLLDHLEDRMPFEDEAVPPQALSEQSDEAGAALSPLPEVPPWTGEVSPAQRDGEALGRSTWEASERSALLKSKLRALLTAPRSLRRSSCFGGRIDRIGAQSGLGCNSFRYRR
  • Signal peptide:  MGPFSTITVSFLFCLAFWHPDQIGA
  • Modification:  T6 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Atrial natriuretic peptide]: Hormone that plays a key role in mediating cardio-renal homeostasis, and is involved in vascular remodeling and regulating energy metabolism (By similarity). Acts by specifically binding and stimulating NPR1 to produce cGMP,
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPR1, NPR3
  • Target Unid:  G1TXB5, G1SZF5
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 25.2 seconds ( PubMed ID: 1697165 )

Structure

  • Disulfide bond:  45861
  • Structure ID:  AF-P07500-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006388_AF2.pdbhor006388_ESM.pdb

Physical Information

Mass: 354621 Formula: C128H207N45O39S2
Absent amino acids: EHKMPTVW Common amino acids: GRS
pI: 10.95 Basic residues: 5
Polar residues: 14 Hydrophobic residues: 7
Hydrophobicity: -40.36 Boman Index: -7793
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 59.29
Instability Index: 8255.36 Extinction Coefficient cystines: 1615
Absorbance 280nm: 59.81

Literature

  • PubMed ID:  2934062##1697165
  • Title:  Structure of dog and rabbit precursors of atrial natriuretic polypeptides deduced from nucleotide sequence of cloned cDNA.