HORDB

General Information

ID: hor006374
Uniprot ID: P01274
Protein name: Glicentin-related polypeptide
Gene name: GCG
Organism: Sus scrofa (Pig)
Family: Glucagon family
Source: Animal
Expression: Glucagon release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. GLP-1 and GLP-2 are induced in response to nutrient ingestion (By similarity). |Glucagon is secreted in the A cells of the islets of Langerhans. GLP-
Disease: NA
Comments: NA
Taxonomy: Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0031769 glucagon receptor binding; GO:0042802 identical protein binding; GO:0048018 receptor ligand activity
GO BP: GO:0006094 gluconeogenesis; GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0010737 protein kinase A signaling; GO:0010800 positive regulation of peptidyl-threonine phosphorylation; GO:0014823 response to activity; GO:0033138 positive regulation of peptidyl-serine phosphorylation; GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus; GO:0042593 glucose homeostasis; GO:0043066 negative regulation of apoptotic process; GO:0045722 positive regulation of gluconeogenesis; GO:0050796 regulation of insulin secretion; GO:0050896 response to stimulus; GO:0051571 obsolete positive regulation of histone H3-K4 methylation; GO:0070374 positive regulation of ERK1 and ERK2 cascade; GO:0071377 cellular response to glucagon stimulus; GO:0090280 positive regulation of calcium ion import; GO:1900118 negative regulation of execution phase of apoptosis
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0005886 plasma membrane

Sequence Information

Sequence: RSLQNTEEKSRSFPAPQTDPLDDPDQMTED
Length: 30(21-50)
Propeptide: MKTIYFVAGLFVMLVQGSWQRSLQNTEEKSRSFPAPQTDPLDDPDQMTEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVTIVEELRRRHADGSFSDEMNTVLDNLATRDFINWLLHTKITDSL
Signal peptide: MKTIYFVAGLFVMLVQGSWQ
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Activity

Function: [Glucagon]: Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypogl
Mechanism: GLP-2 does not have cleavage on a pair of basic residues at C-terminus as in other mammals.
Cross BBB: NA
Target: GLP1R, GLP2R
Target Unid: F1RVR1, A0A286ZPF4
IC50: NA
EC50: NA
ED50: NA
Kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-P01274-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006374_AF2.pdb

hor006374_ESM.pdb

Physical Information

Mass:	396607	Formula:	C142H223N41O57S
Absent amino acids:	CGHIVWY	Common amino acids:	D
pI:	3.83	Basic residues:	3
Polar residues:	7	Hydrophobic residues:	4
Hydrophobicity:	-172.33	Boman Index:	-12361
Half-Life / Aliphatic Index:	1 hour	Aliphatic Index:	29.33
Instability Index:	10575	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

Literature

PubMed ID: 6894800
Title: The primary structure of porcine glicentin (proglucagon).
PubMed ID: 7045833
Title: The amino acid sequence of porcine glicentin.
PubMed ID: 2753890
Title: Complete sequences of glucagon-like peptide-1 from human and pig small intestine.
PubMed ID: 3379036
Title: Naturally occurring products of proglucagon 111-160 in the porcine
PubMed ID: 3530719
Title:
PubMed ID: 12554744
Title:
PubMed ID: 12626323
Title:
PubMed ID: 10322410
Title:
PubMed ID: 10605628
Title:
PubMed ID: 171582
Title: