HORDB

ID: hor006370
Uniprot ID: P01273
Protein name: Glucagon-like peptide 2
Gene name: GCG
Organism: Mesocricetus auratus (Golden hamster)
Family: Glucagon family
Source: Animal
Expression: Glucagon release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. GLP-1 and GLP-2 are induced in response to nutrient ingestion (By similarity).
Disease: NA
Comments: NA
Taxonomy: Mesocricetus (genus), Cricetinae (subfamily), Cricetidae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction; GO:0014823 response to activity; GO:0042593 glucose homeostasis; GO:0050796 regulation of insulin secretion; GO:0050896 response to stimulus
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: HADGSFSDEMNTILDSLATRDFINWLIQTKITD
Length: 33(146-178)
Propeptide: MKNIYIVAGFFVVLVQGSWQHSLQDTEEKSRSFPASQTDPLEDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVTIVEELGRRHADGSFSDEMNTILDSLATRDFINWLIQTKITDKK
Signal peptide: MKNIYIVAGFFVVLVQGSWQ
Modification: T5 Phosphoserine;T7 Phosphoserine
Glycosylation: NA
Mutagenesis: NA

Function: [Glucagon]: Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypogl
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006370_AF2.pdb

hor006370_ESM.pdb

Mass:	434014	Formula:	C165H255N43O56S
Absent amino acids:	CPVY	Common amino acids:	D
pI:	4.01	Basic residues:	3
Polar residues:	10	Hydrophobic residues:	12
Hydrophobicity:	-27.58	Boman Index:	-6520
Half-Life:	3.5 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	88.79
Instability Index:	1196.36	Extinction Coefficient cystines:	5500
Absorbance 280nm:	171.88

PubMed ID: 6835407
Title: Hamster preproglucagon contains the sequence of glucagon and two related peptides.
PubMed ID: 12554744
Title: Glucagon-like peptides: regulators of cell proliferation, differentiation, and apoptosis.
PubMed ID: 12626323
Title: Glucagon and regulation of glucose metabolism.
PubMed ID: 10322410
Title: Glucagon-like Peptide 2.
PubMed ID: 10605628
Title: The gl