General Information

  • ID:  hor006356
  • Uniprot ID:  O12956
  • Protein name:  Glucagon
  • Gene name:  GCG
  • Organism:  Heloderma suspectum (Gila monster)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.|Isoform LPII is expressed in both pancreas and intestine. Expression of isoform LPI is restricted to the pancreas. Neither isoform is detected in saliv
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Heloderma (genus), Helodermatidae (family), Neoanguimorpha , Anguimorpha (infraorder), Toxicofera , Episquamata , Unidentata , Bifurcata , Squamata (order), Lepidosauria (class), Sauria , Sauropsida , Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSQGTFTSDYSKYLDTRRAQDFVQWLMNT
  • Length:  29(53-81)
  • Propeptide:  MTSMYFVAGLLLMIVQGSWQSPLQETEEKSRSFKASQAEPLDDSRQLNEVKRHSQGTFTSDYSKYLDTRRAQDFVQWLMNTKRSGQQGVEEREKENLLDQLSSNGLARHHAEYERHADGRYTSDISSYLEGQAAKEFIAWLVNGRGRRDFLEEAGTADDIGRRHADGTFTSDYNQLLDDIATQEFLKWLINQKVTQRDLLGEYQ
  • Signal peptide:  MTSMYFVAGLLLMIVQGSWQ
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Glucagon]: Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O12956-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006356_AF2.pdbhor006356_ESM.pdb

Physical Information

Mass: 399642 Formula: C154H227N43O49S
Absent amino acids: CEIP Common amino acids: T
pI: 7.54 Basic residues: 4
Polar residues: 11 Hydrophobic residues: 7
Hydrophobicity: -98.62 Boman Index: -8296
Half-Life / Aliphatic Index: 3.5 hour Aliphatic Index: 40.34
Instability Index: 3756.21 Extinction Coefficient cystines: 8480
Absorbance 280nm: 302.86

Literature

  • PubMed ID:  9020121
  • Title:  Tissue-specific expression of unique mRNAs that encode proglucagon-derived peptides or exendin 4 in the lizard.
  • PubMed ID:  9545315
  • Title:  Molecular cloning of the helodermin and exendin-4 cDNAs in the lizard. Relationship to vasoactive intestinal polypeptide/pituitary adenylate c
  • PubMed ID:  12554744
  • Title:  
  • PubMed ID:  12626323
  • Title:  
  • PubMed ID:  10322410
  • Title:  
  • PubMed ID:  10605628
  • Title: