HORDB

ID: hor006351
Uniprot ID: O00230
Protein name: Cortistatin-29
Gene name: CORT
Organism: Homo sapiens (Human)
Family: Somatostatin family
Source: Human
Expression: Expressed in a subset of GABAergic cells in the cortex and hippocampus.
Disease: Diseases associated with CORT include Prolactinoma and Neuroblastoma.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
GO BP: GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway; GO:0007268 chemical synaptic transmission; GO:0030334 regulation of cell migration
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0045202 synapse

Sequence: QEGAPPQQSARRDRMPCRNFFWKTFSSCK
Length: 29(77-105)
Propeptide: MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQASAGPLIGEEAREVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK
Signal peptide: MPLSPGLLLLLLSGATAT
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Binds to all human somatostatin receptor (SSTR) subtypes. It also inhibits cAMP production induced by forskolin through SSTRs.
Mechanism: NA
Cross BBB: NA
Target: SSTR5
Target Unid: P35346
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006351_AF2.pdb

hor006351_ESM.pdb

Mass:	395951	Formula:	C149H228N48O42S3
Absent amino acids:	HILVY	Common amino acids:	R
pI:	10.75	Basic residues:	6
Polar residues:	8	Hydrophobic residues:	6
Hydrophobicity:	-127.93	Boman Index:	-10160
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	6.9
Instability Index:	10600	Extinction Coefficient cystines:	5625
Absorbance 280nm:	200.89

PubMed ID: 9125122
Title: Identification and characterization of a novel human cortistatin-like peptide.
PubMed ID: 9205124
Title: Cloning, mRNA expression, and chromosomal mapping of mouse and human preprocortistatin.
PubMed ID: 16710414
Title: The DNA sequence and biological annotation of human chromosome 1.
PubMed ID: 15489334
Title: The status, quality
PubMed ID: 12975309
Title: