General Information

  • ID:  hor006348
  • Uniprot ID:  Q9WUG6
  • Protein name:  Insulin-like peptide INSL5 A chain
  • Gene name:  Insl5
  • Organism:  Mus musculus (Mouse)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  Highest expression in colon with lower levels in thymus. Minimal levels in testis.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:2000253 positive regulation of feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0062023 collagen-containing extracellular matrix

Sequence Information

  • Sequence:  RDLQALCCREGCSMKELSTLC
  • Length:  21(115-135)
  • Propeptide:  MKGPTLALFLLLVLLAVVEVRSRQTVKLCGLDYVRTVIYICASSRWRRHLEGHFHSQQAETRNYLQLLDRHEPSKKTLEHSLPKTDLSGQELVRDPQAPKEGLWELKKHSVVSRRDLQALCCREGCSMKELSTLC
  • Signal peptide:  MKGPTLALFLLLVLLAVVEVRS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May have a role in gut contractility or in thymic development and regulation. Activates RXFP4 with high potency and appears to be the endogenous ligand for this receptor (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Rxfp4
  • Target Unid:  Q7TQP4
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45850
  • Structure ID:  AF-Q9WUG6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006348_AF2.pdbhor006348_ESM.pdb

Physical Information

Mass: 271673 Formula: C93H163N29O32S5
Absent amino acids: FHINPVWY Common amino acids: CL
pI: 6.2 Basic residues: 3
Polar residues: 8 Hydrophobic residues: 5
Hydrophobicity: -3.33 Boman Index: -4274
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 79.05
Instability Index: 2504.76 Extinction Coefficient cystines: 250
Absorbance 280nm: 12.5

Literature

  • PubMed ID:  10458910
  • Title:  Identification of INSL5, a new member of the insulin superfamily.
  • PubMed ID:  10598589
  • Title:  Cloning of two novel mammalian paralogs of relaxin/insulin family proteins and their expression in testis and kidney.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA projec