General Information

  • ID:  hor006344
  • Uniprot ID:  Q9W0W6
  • Protein name:  NPLP1-2
  • Gene name:  Nplp1
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  NA
  • Source:  Animal
  • Expression:  MTYamide peptide: Expressed in the larval CNS (at protein level). NAP peptide: Expressed in the larval CNS (at protein level). IPNamide peptide: Expressed in the ventral ganglion of the third larval instar and adult brain (at protein level).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0048018 receptor ligand activity
  • GO BP:  GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  NIATMARLQSAPSTHRDP
  • Length:  18(186-203)
  • Propeptide:  MQAVLQSAHSSRRLMLLLSMLLNAAIQPRSIIVSATDDVANVSPCEMESLINQLMSPSPEYQLHASALRNQLKNLLRERQLAVGEEQPLGEYPDYLEEDKRSVAALAAQGLLNAPKRSLATLAKNGQLPTAEPGEDYGDADSGEPSEQKRYIGSLARAGGLMTYGKRNVGTLARDFQLPIPNGKRNIATMARLQSAPSTHRDPKRNVAAVARYNSQHGHIQRAGAEKRNLGALKSSPVHGVQQKREDEEMLLPAA
  • Signal peptide:  MQAVLQSAHSSRRLMLLLSMLLNAAIQP
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [NPLP1-4]: Acts as a ligand for the receptor-type guanylate cyclase Gyc76C (PubMed:21893139). Stimulates Gyc76c-dependent cGMP production and modulates the IMD innate immune pathway in response to salt stress by inducing nuclear translocation of NF-kappa-
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9W0W6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006344_AF2.pdbhor006344_ESM.pdb

Physical Information

Mass: 226961 Formula: C81H136N28O27S
Absent amino acids: CEFGKVWY Common amino acids: A
pI: 10.4 Basic residues: 3
Polar residues: 5 Hydrophobic residues: 5
Hydrophobicity: -73.89 Boman Index: -4972
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 60
Instability Index: 10463.33 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  10731132
  • Title:  The genome sequence of Drosophila melanogaster.
  • PubMed ID:  12537572
  • Title:  Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
  • PubMed ID:  12537569
  • Title:  A Drosophila full-length cDNA resource.
  • PubMed ID:  12171930
  • Title:  Peptidomics of the larval Drosophila melanogaster central nervous system.
  • PubMed ID:  14690519
  • Title:  Expres
  • PubMed ID:  21893139
  • Title:  
  • PubMed ID:  26440503
  • Title: