General Information

  • ID:  hor006342
  • Uniprot ID:  Q9VT53
  • Protein name:  Probable insulin-like peptide 4 B chain
  • Gene name:  Ilp4
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  Expressed in the embryo (beginning at the blastoderm stage), and in the larva. |Expressed at a high level in the embryonic mesoderm, with expression continuing after gastrulation and reducing from stage 12 onwards. Highly expressed in the embryonic anteri
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   melanogaster subgroup , melanogaster group , Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae , Schizophora , Cyclorrhapha , Eremoneura , Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005158 insulin receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway; GO:0008286 insulin receptor signaling pathway; GO:0030536 larval feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  RRKMCGEALIQALDVICVNGFT
  • Length:  22(27-48)
  • Propeptide:  MSLIRLGLALLLLLATVSQLLQPVQGRRKMCGEALIQALDVICVNGFTRRVRRSSASKDARVRDLIRKLQQPDEDIEQETETGRLKQKHTDADTEKGVPPAVGSGRKLRRHRRRIAHECCKEGCTYDDILDYCA
  • Signal peptide:  MSLIRLGLALLLLLATVSQLLQPVQG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  InR
  • Target Unid:  P09208
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9VT53-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006342_AF2.pdbhor006342_ESM.pdb

Physical Information

Mass: 281270 Formula: C104H177N31O30S3
Absent amino acids: HPSWY Common amino acids: ACGILRV
pI: 8.23 Basic residues: 3
Polar residues: 6 Hydrophobic residues: 9
Hydrophobicity: 45 Boman Index: -2452
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 106.36
Instability Index: 3671.36 Extinction Coefficient cystines: 125
Absorbance 280nm: 5.95

Literature

  • PubMed ID:  10731132
  • Title:  The genome sequence of Drosophila melanogaster.
  • PubMed ID:  12537572
  • Title:  Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
  • PubMed ID:  12537569
  • Title:  A Drosophila full-length cDNA resource.
  • PubMed ID:  11250149
  • Title:  An evolutionarily conserved function of the Drosophila insulin receptor and insul