General Information

  • ID:  hor006337
  • Uniprot ID:  Q9VT51
  • Protein name:  Probable insulin-like peptide 2 A chain
  • Gene name:  Ilp2
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  Expressed in the embryo and larva. |Broadly expressed at a low level in the embryonic mesoderm, beginning at stage 12. Expressed at a high level in the embryonic anterior midgut, with expression diminishing at late stage 16. Expressed at a low level in la
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   melanogaster subgroup , melanogaster group , Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae , Schizophora , Cyclorrhapha , Eremoneura , Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005158 insulin receptor binding; GO:0005179 hormone activity; GO:0008083 growth factor activity; GO:0048018 receptor ligand activity
  • GO BP:  GO:0007623 circadian rhythm; GO:0008284 positive regulation of cell population proliferation; GO:0008286 insulin receptor signaling pathway; GO:0008340 determination of adult lifespan; GO:0008361 regulation of cell size; GO:0030307 positive regulation of cell growth; GO:0030431 sleep; GO:0030536 larval feeding behavior; GO:0032094 response to food; GO:0033500 carbohydrate homeostasis; GO:0040009 regulation of growth rate; GO:0040014 regulation of multicellular organism growth; GO:0040018 positive regulation of multicellular organism growth; GO:0042593 glucose homeostasis; GO:0045475 locomotor rhythm; GO:0045793 positive regulation of cell size; GO:0045818 negative regulation of glycogen catabolic process; GO:0046620 regulation of organ growth; GO:0046622 positive regulation of organ growth; GO:0060180 female mating behavior; GO:0060250 germ-line stem-cell niche homeostasis; GO:0061964 negative regulation of entry into reproductive diapause; GO:0070328 triglyceride homeostasis; GO:0071333 cellular response to glucose stimulus; GO:1990928 response to amino acid starvation; GO:2000252 negative regulation of feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  TRQRQGIVERCCKKSCDMKALREYCSVVRN
  • Length:  30(108-137)
  • Propeptide:  MSKPLSFISMVAVILLASSTVKLAQGTLCSEKLNEVLSMVCEEYNPVIPHKRAMPGADSDLDALNPLQFVQEFEEEDNSISEPLRSALFPGSYLGGVLNSLAEVRRRTRQRQGIVERCCKKSCDMKALREYCSVVRN
  • Signal peptide:  MSKPLSFISMVAVILLASSTVKLAQG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays a role in regulating body size by increasing cell size and cell number of individual organs. Probably mediates its growth effects by acting as a ligand for the insulin receptor and transducing a signal via the Chico/PI3K/Akt(PKB) pathway.
  • Mechanism:  Of the insulin-like peptides, Ilp2 is the closest homolog of human insulin.
  • Cross BBB:  NA
  • Target:  InR
  • Target Unid:  P09208
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45977
  • Structure ID:  AF-Q9VT51-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006337_AF2.pdbhor006337_ESM.pdb

Physical Information

Mass: 407864 Formula: C144H251N51O44S5
Absent amino acids: FHPW Common amino acids: R
pI: 9.58 Basic residues: 8
Polar residues: 10 Hydrophobic residues: 6
Hydrophobicity: -82 Boman Index: -10864
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 58.33
Instability Index: 4466.67 Extinction Coefficient cystines: 1740
Absorbance 280nm: 60

Literature

  • PubMed ID:  11179818
  • Title:  Neuropeptides and their precursors in the fruitfly, Drosophila melanogaster.
  • PubMed ID:  10731132
  • Title:  The genome sequence of Drosophila melanogaster.
  • PubMed ID:  12537572
  • Title:  Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
  • PubMed ID:  12537569
  • Title:  A Drosophila full-length cDNA resource.
  • PubMed ID:  11250149
  • Title:  An