General Information

  • ID:  hor006328
  • Uniprot ID:  Q9ESQ8
  • Protein name:  Neuropeptide NPVF
  • Gene name:  Npvf
  • Organism:  Mus musculus (Mouse)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0032277 negative regulation of gonadotropin secretion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VNMEAGTRSHFPSLPQRF
  • Length:  18(108-125)
  • Propeptide:  MEIISLKRFILLTVATSSFLTSNTFCTDEFMMPHFHSKEGDGKYSQLRGIPKGEKERSVSFQELKDWGAKNVIKMSPAPANKVPHSAANLPLRFGRTIDEKRSPAARVNMEAGTRSHFPSLPQRFGRTTARSPKTPADLPQKPLHSLGSSELLYVMICQHQEIQSPGGKRTRRGAFVETDDAERKPEK
  • Signal peptide:  MEIISLKRFILLTVATSSFLTSNTFC
  • Modification:  T18 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuropeptide RFRP-1 acts as a potent negative regulator of gonadotropin synthesis and secretion. Neuropeptides NPSF and NPVF efficiently inhibit forskolin-induced production of cAMP. Neuropeptide NPVF blocks morphine-induced analgesia (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9ESQ8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006328_AF2.pdbhor006328_ESM.pdb

Physical Information

Mass: 237773 Formula: C91H140N28O26S
Absent amino acids: CDIKWY Common amino acids: FPRS
pI: 10.4 Basic residues: 3
Polar residues: 5 Hydrophobic residues: 5
Hydrophobicity: -62.78 Boman Index: -4284
Half-Life / Aliphatic Index: 100 hour Aliphatic Index: 43.33
Instability Index: 6617.78 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  11025660
  • Title:  New neuropeptides containing carboxy-terminal RFamide and their receptor in mammals.
  • PubMed ID:  11481330
  • Title:  Identification and characterization of novel mammalian neuropeptide FF-like peptides that attenuate morphine-induced antinociception.