General Information

  • ID:  hor006325
  • Uniprot ID:  Q9BDJ6
  • Protein name:  Ghrelin
  • Gene name:  GHRL
  • Organism:  Bos taurus (Bovine)
  • Family:  Motilin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0016608 growth hormone-releasing hormone activity; GO:0030296 protein tyrosine kinase activator activity; GO:0031768 ghrelin receptor binding
  • GO BP:  GO:0001696 gastric acid secretion; GO:0001937 negative regulation of endothelial cell proliferation; GO:0007165 signal transduction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0008154 actin polymerization or depolymerization; GO:0009725 response to hormone; GO:0016358 dendrite development; GO:0032024 positive regulation of insulin secretion; GO:0032095 regulation of response to food; GO:0032097 positive regulation of response to food; GO:0032691 negative regulation of interleukin-1 beta production
  • GO CC:  NA

Sequence Information

  • Sequence:  GSSFLSPEHQKLQRKEAKKPSGRLKPR
  • Length:  27(24-50)
  • Propeptide:  MPAPWTICSLLLLSVLCMDLAMAGSSFLSPEHQKLQRKEAKKPSGRLKPRTLEGQFDPEVGSQAEGAEDELEIRFNAPFNIGIKLAGAQSLQHGQTLGKFLQDILWEEAEETLANE
  • Signal peptide:  MPAPWTICSLLLLSVLCMDLAMA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Ghrelin]: Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in gro
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  GHSR
  • Target Unid:   B5U8Y5
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9BDJ6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006325_AF2.pdbhor006325_ESM.pdb

Physical Information

Mass: 355449 Formula: C135H229N45O38
Absent amino acids: CDIMNTVWY Common amino acids: K
pI: 11.78 Basic residues: 9
Polar residues: 6 Hydrophobic residues: 5
Hydrophobicity: -159.26 Boman Index: -9404
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 47.04
Instability Index: 4122.22 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA