General Information

  • ID:  hor006318
  • Uniprot ID:  Q90WZ1
  • Protein name:  Maximakinin
  • Gene name:  NA
  • Organism:  Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad)
  • Family:  Bradykinin-related peptide family
  • Source:  Animal
  • Expression:  Expressed by the skin glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bombina (genus), Bombinatoridae (family), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0090729 toxin activity
  • GO BP:  GO:0006952 defense response; GO:0007165 signal transduction; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0045987 positive regulation of smooth muscle contraction; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DLPKINRKGPRPPGFSPFR
  • Length:  19(41-59)
  • Propeptide:  MRLWFCLSFFIVLCLEHFPETLADERNVPESEEKTEQYLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPPGFSPFRGKFHSQSHV
  • Signal peptide:  MRLWFCLSFFIVLCLEHFPETLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  In vitro, produces constriction of guinea pig ileum smooth muscle. May target bradykinin receptors (BDKRB).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q90WZ1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006318_AF2.pdbhor006318_ESM.pdb

Physical Information

Mass: 250077 Formula: C100H159N31O24
Absent amino acids: ACEHMQTVWY Common amino acids: P
pI: 12.24 Basic residues: 5
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: -126.32 Boman Index: -5694
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 41.05
Instability Index: 6024.21 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  11500030
  • Title:  A novel bradykinin-related peptide from skin secretions of toad Bombina maxima and its precursor containing six identical copies of the final product.