General Information

  • ID:  hor006305
  • Uniprot ID:  Q8AXR2
  • Protein name:  C-type natriuretic peptide 2
  • Gene name:  cnp-1-2
  • Organism:  Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  Expressed in brain and to a low extent in atrium.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii , Euteleosteomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GWNRGCFGLKLDRIGSMSGLGC
  • Length:  22(110-131)
  • Propeptide:  MLYPALLCAALLLIAPLGHTEGRTLYPSPDAIQFVEQFLDRYNDLTLDDLENLVSSQPEEPSSAFTSGVKIAEYPKWADIPAQGDSTWLRLLKGTLANQKRAVTDRSRRGWNRGCFGLKLDRIGSMSGLGC
  • Signal peptide:  MLYPALLCAALLLIAPLGHTEG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Exhibits natriuretic and vasodepressor activity. Has a cGMP-stimulating activity (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45830
  • Structure ID:  AF-Q8AXR2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006305_AF2.pdbhor006305_ESM.pdb

Physical Information

Mass: 270249 Formula: C99H159N31O28S3
Absent amino acids: AEHPQTVY Common amino acids: G
pI: 8.83 Basic residues: 3
Polar residues: 11 Hydrophobic residues: 6
Hydrophobicity: 3.64 Boman Index: -2201
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 70.91
Instability Index: 2573.18 Extinction Coefficient cystines: 5625
Absorbance 280nm: 267.86

Literature

  • PubMed ID:  12568796
  • Title:  C-type natriuretic peptide of rainbow trout (Oncorhynchus mykiss): primary structure and vasorelaxant activities.