General Information

  • ID:  hor006303
  • Uniprot ID:  Q805D8
  • Protein name:  Atrial natriuretic factor
  • Gene name:  nppa
  • Organism:  Takifugu rubripes (Japanese pufferfish) (Fugu rubripes)
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Takifugu (genus), Tetraodontidae (family), Tetradontoidea (superfamily), Tetraodontoidei (suborder), Tetraodontiformes (order), Eupercaria , Percomorphaceae , Euacanthomorphacea , Acanthomorphata , Ctenosquamata , Eurypterygia , Neoteleostei , Euteleosteomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ASSCFGARMDRIGNASGLGCNNGRG
  • Length:  25(115-139)
  • Propeptide:  MTALVLWGLLLLLGQHTQVNSHVLGRPFSASDSSQLKSLLERLEETISEADQEQNPELDQEVEYDIRDQDPGQRWNLDLGRDQDQVTATRSEIHSRPSVQRSHLQDLLMSLRKRASSCFGARMDRIGNASGLGCNNGRG
  • Signal peptide:  MTALVLWGLLLLLGQHTQVNS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis, diuresis, and vasodilation. Has a cGMP-stimulating activity (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45767
  • Structure ID:  AF-Q805D8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006303_AF2.pdbhor006303_ESM.pdb

Physical Information

Mass: 290000 Formula: C96H159N37O34S3
Absent amino acids: EHKPQTVWY Common amino acids: G
pI: 8.83 Basic residues: 3
Polar residues: 14 Hydrophobic residues: 6
Hydrophobicity: -35.6 Boman Index: -5480
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 43.2
Instability Index: 1112.8 Extinction Coefficient cystines: 125
Absorbance 280nm: 5.21

Literature

  • PubMed ID:  15072558
  • Title:  Four natriuretic peptides (ANP, BNP, VNP and CNP) coexist in the sturgeon: identification of BNP in fish lineage.