HORDB

ID: hor006299
Uniprot ID: Q7T3L1
Protein name: Bombinakinin-GAP
Gene name: NA
Organism: Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad)
Family: Bradykinin-related peptide family
Source: Animal
Expression: Expressed by the skin glands.
Disease: NA
Comments: NA
Taxonomy: Bombina (genus), Bombinatoridae (family), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0090729 toxin activity
GO BP: GO:0006952 defense response; GO:0007165 signal transduction; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0042755 eating behavior; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region

Sequence: DMYEIKQYKTAHGRPPICAPGEQCPIWV
Length: 28(265-292)
Propeptide: MRLWFCLSFFIVLCLEHFTGTLADERNVPESEEKTEQFLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPPGFSPFRGKFHSQSLRDLPKINRKGPRPPGFSPFR
Signal peptide: MRLWFCLSFFIVLCLEHFTGTLA
Modification: T28 Valine amide
Glycosylation: NA
Mutagenesis: NA

Function: [Bombinakinin-GAP]: Plays a role in the control of feeding by the brain; intracerebroventricular administration of the peptide induced significant decrease in food intake in rats. Inhibits the bradykinin-induced in vitro relaxation of rat arterial smooth
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006299_AF2.pdb

hor006299_ESM.pdb

Mass:	371354	Formula:	C145H220N38O40S3
Absent amino acids:	FLNS	Common amino acids:	P
pI:	7.25	Basic residues:	4
Polar residues:	7	Hydrophobic residues:	7
Hydrophobicity:	-57.86	Boman Index:	-3541
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	59.29
Instability Index:	4425.71	Extinction Coefficient cystines:	8605
Absorbance 280nm:	318.7

PubMed ID: 12668203
Title: Bombinakinin M gene associated peptide, a novel bioactive peptide from skin secretions of the toad Bombina maxima.
PubMed ID: 20138946
Title: Peptide DV-28 amide: An inhibitor of bradykinin-induced arterial smooth muscle relaxation encoded by Bombina orientalis skin kininogen-2.