General Information

  • ID:  hor006293
  • Uniprot ID:  Q7KUD5
  • Protein name:  Probable insulin-like peptide 5 A chain
  • Gene name:  Ilp5
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  Expressed in the larva but not in the embryo. |Expressed at a high level in seven cells of each larval brain hemisphere that may correspond to neurosecretory cells. Expressed at a moderate level in the larval gut.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   melanogaster subgroup , melanogaster group , Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae , Schizophora , Cyclorrhapha , Eremoneura , Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005158 insulin receptor binding; GO:0005179 hormone activity; GO:0005515 protein binding; GO:0048018 receptor ligand activity
  • GO BP:  GO:0007623 circadian rhythm; GO:0007626 locomotory behavior; GO:0008286 insulin receptor signaling pathway; GO:0030431 sleep; GO:0033500 carbohydrate homeostasis; GO:0060180 female mating behavior; GO:0061964 negative regulation of entry into reproductive diapause
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  DFRGVVDSCCRKSCSFSTLRAYCDS
  • Length:  25(84-108)
  • Propeptide:  MMFRSVIPVLLFLIPLLLSAQAANSLRACGPALMDMLRVACPNGFNSMFAKRGTLGLFDYEDHLADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSCSFSTLRAYCDS
  • Signal peptide:  MMFRSVIPVLLFLIPLLLSAQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  InR
  • Target Unid:   P09208
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45914
  • Structure ID:  AF-Q7KUD5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006293_AF2.pdbhor006293_ESM.pdb

Physical Information

Mass: 323441 Formula: C115H181N35O39S4
Absent amino acids: EHIMNPQW Common amino acids: S
pI: 7.91 Basic residues: 4
Polar residues: 12 Hydrophobic residues: 6
Hydrophobicity: -18.8 Boman Index: -6935
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 42.8
Instability Index: 5407.2 Extinction Coefficient cystines: 1740
Absorbance 280nm: 72.5

Literature

  • PubMed ID:  10731132
  • Title:  The genome sequence of Drosophila melanogaster.
  • PubMed ID:  12537572
  • Title:  Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
  • PubMed ID:  11250149
  • Title:  An evolutionarily conserved function of the Drosophila insulin receptor and insulin-like peptides in growth control.
  • PubMed ID:  14709175
  • Title:  An i