General Information

  • ID:  hor006289
  • Uniprot ID:  Q6BEG6
  • Protein name:  Ghrelin
  • Gene name:  GHRL
  • Organism:  Felis catus (Cat) (Felis silvestris catus)
  • Family:  Motilin family
  • Source:  Animal
  • Expression:  2.5-fold increase in plasma level of ghrelin upon fasting.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Felis (genus), Felinae (subfamily), Felidae (family), Feliformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0016608 growth hormone-releasing hormone activity; GO:0030296 protein tyrosine kinase activator activity; GO:0031768 ghrelin receptor binding
  • GO BP:  GO:0001696 gastric acid secretion; GO:0001937 negative regulation of endothelial cell proliferation; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007416 synapse assembly; GO:0008154 actin polymerization or depolymerization; GO:0009725 response to hormone; GO:0016358 dendrite development; GO:0032024 positive regulation of insulin secretion; GO:0032095 regulation of response to food; GO:0032097 positive regulation of response to food; GO:0032100 positive regulation of appetite; GO:0032691 negative regulation of interleukin-1 beta production; GO:0032715 negative regulation of interleukin-6 production; GO:0032720 negative regulation of tumor necrosis factor production; GO:0040013 negative regulation of locomotion; GO:0042127 regulation of cell population proliferation; GO:0042322 negative regulation of circadian sleep/wake cycle, REM sleep; GO:0043066 negative regulation of apoptotic process; GO:0043410 positive regulation of MAPK cascade; GO:0043627 response to estrogen; GO:0046010 positive regulation of circadian sleep/wake cycle, non-REM sleep; GO:0046676 negative regulation of insulin secretion; GO:0046697 decidualization; GO:0050728 negative regulation of inflammatory response; GO:0051461 positive regulation of corticotropin secretion; GO:0051464 positive regulation of cortisol secretion; GO:0051965 positive regulation of synapse assembly; GO:0060079 excitatory postsynaptic potential; GO:0060124 positive regulation of growth hormone secretion; GO:0120162 positive regulation of cold-induced thermogenesis
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0030424 axon; GO:0098794 postsynapse

Sequence Information

  • Sequence:  GSSFLSPEHQKVQQRKESKKPPAKLQPR
  • Length:  28(24-51)
  • Propeptide:  MPSPGTVCSLLLFSMLWADLAMAGSSFLSPEHQKVQQRKESKKPPAKLQPRALEGLIHPEDTSQVEGAEDELEIRFNAPFDVGIKLSGAQYHQHGQALGKFLQDVLWEEADEVLADE
  • Signal peptide:  MPSPGTVCSLLLFSMLWADLAMA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Ghrelin]: Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in gro
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  GHSR
  • Target Unid:  M3WES4
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6BEG6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006289_AF2.pdbhor006289_ESM.pdb

Physical Information

Mass: 369844 Formula: C141H235N45O41
Absent amino acids: CDIMNTWY Common amino acids: K
pI: 11.34 Basic residues: 8
Polar residues: 5 Hydrophobic residues: 5
Hydrophobicity: -165.36 Boman Index: -9202
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 41.79
Instability Index: 7031.43 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16466902
  • Title:  Purification and characterization of feline ghrelin and its possible role.