General Information

  • ID:  hor006284
  • Uniprot ID:  Q64171
  • Protein name:  Relaxin A chain
  • Gene name:  RLN
  • Organism:  Mesocricetus auratus (Golden hamster)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Mesocricetus (genus), Cricetinae (subfamily), Cricetidae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YTSIYMSHQCCFRGCSRRSLTAAC
  • Length:  24(154-177)
  • Propeptide:  MSCKFVLQLLGFWLLLSQPCRARVTKEWLDEVIHVCGREYVRAILDICAATVGLEAPPLRRRRMTEEAVSSFIKEDAEPFDTMPNLSEKPKTALPEGHPSLPEQQQYVPVSSDSVGSLDDFKKSFHATQGEAEDSSLPELKSLYLDTLSRKKRYTSIYMSHQCCFRGCSRRSLTAAC
  • Signal peptide:  MSCKFVLQLLGFWLLLSQPCRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. It bears mature young, and allows separation of the pelvic bones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Rxfp1, Rxfp2
  • Target Unid:  A0A3Q0D0K7, A0A1U8CIF3
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45945
  • Structure ID:  AF-Q64171-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006284_AF2.pdbhor006284_ESM.pdb

Physical Information

Mass: 315560 Formula: C113H178N36O34S5
Absent amino acids: DEKNPVW Common amino acids: CS
pI: 8.67 Basic residues: 4
Polar residues: 13 Hydrophobic residues: 5
Hydrophobicity: -5 Boman Index: -4913
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 40.83
Instability Index: 10449.17 Extinction Coefficient cystines: 3230
Absorbance 280nm: 140.43

Literature

  • PubMed ID:  7492700
  • Title:  Determination of the prorelaxin nucleotide sequence and expression of prorelaxin messenger ribonucleic acid in the golden hamster.