General Information

  • ID:  hor006280
  • Uniprot ID:  Q5CZK6
  • Protein name:  Early placenta insulin-like peptide B chain
  • Gene name:  INSL4
  • Organism:  Pan troglodytes (Chimpanzee)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Pan (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWL
  • Length:  33(26-58)
  • Propeptide:  MASLFWSYLPAIWLLLSQLLRESLAAELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPTEMVSTSNNKDGQTLGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCT
  • Signal peptide:  MASLFWSYLPAIWLLLSQLLRESLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May play an important role in trophoblast development and in the regulation of bone formation.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q5CZK6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006280_AF2.pdbhor006280_ESM.pdb

Physical Information

Mass: 422321 Formula: C165H252N44O44S3
Absent amino acids: DINQV Common amino acids: G
pI: 8.8 Basic residues: 5
Polar residues: 13 Hydrophobic residues: 8
Hydrophobicity: -35.45 Boman Index: -3365
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 50.3
Instability Index: 4519.39 Extinction Coefficient cystines: 7115
Absorbance 280nm: 222.34

Literature

  • PubMed ID:  16136131
  • Title:  Initial sequence of the chimpanzee genome and comparison with the human genome.
  • PubMed ID:  15707501
  • Title:  Evolution of the relaxin-like peptide family.