General Information

  • ID:  hor006254
  • Uniprot ID:  Q04617
  • Protein name:  Corticotropin
  • Gene name:  pomca
  • Organism:  Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
  • Family:  POMC family
  • Source:  animal
  • Expression:  Expressed in sexually active or inactive fish.|C-terminal peptide 1 and C-terminal peptide 2 are detected in the anterior part of the nucleus lateralis tuberis of hypothalamus, in dorsal hypothalamus, thalamus, telencephalon, optic tectum and medulla oblo
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SYSMEHFRWGKPVGRKRRPVKVYTNGVEEESSEAFPSEM
  • Length:  39
  • Propeptide:  MLCPAWLLAVAVVGVVRGVKGQCWENPRCHDLSSENNLLECIQLCRSDLTTKSPIFPVKVHLQPPSPSDSDSPPLYLPLSLLSPSSPLYPTEQQNSVSPQAKRSYSMEHFRWGKPVGRKRRPVKVYTNGVEEESSEAFPSEMRRELGTDDAVYPSLEAGTAEGGEAEGMEGVFSLQEKKDGSYKMNHFRWSGPPASKRYGGFMKSWDERSQKPLLTLFKNVIIKDGQQKREQWGREEGEEKRALGERKYHFQG
  • Signal peptide:  MLCPAWLLAVAVVGVVRGVKG
  • Modification:  T1 N-acetylserine;T13 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Corticotropin]: Stimulates the adrenal glands to release cortisol.; Melanocyte-stimulating hormone alpha: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; Melanocyte-stimulating hormone beta: Increases the pigmentation of skin by increasing melanin production in melanocytes.; Beta-endorphin: Endogenous orexigenic opiate.; [Met-enkephalin]: Endogenous opiate.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q04617-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006254_AF2.pdbhor006254_ESM.pdb

Physical Information

Mass: 526705 Formula: C202H308N58O61S2
Absent amino acids: CDILQ Common amino acids: E
pI: 9.1 Basic residues: 8
Polar residues: 12 Hydrophobic residues: 8
Hydrophobicity: -111.79 Boman Index: -11456
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 32.31
Instability Index: 8036.92 Extinction Coefficient cystines: 8480
Absorbance 280nm: 223.16

Literature

  • PubMed ID:  1448114
  • Title:  One of the two trout proopiomelanocortin messenger RNAs potentially encodes new peptides.
  • PubMed ID:  9299569
  • Title:  Isolation and structural characterization of two novel peptides derived from proopiomelanocortin in the pituitary of the rainbow trout.
  • PubMed ID:  8977395
  • Title:  Characterization of a novel alpha-amidated decapeptide derived from proopiomelanocortin-A in the trout pituitary.
  • PubMed ID:  10022961
  • Title:  Immunohistochemical localization and biochemical characterization of two novel decapeptides derived from POMC-A in the trout hypothalamus.