HORDB

ID: hor006253
Uniprot ID: Q04617
Protein name: Lipotropin gamma
Gene name: pomca
Organism: Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Family: POMC family
Source: Animal
Expression: Expressed in sexually active or inactive fish.|C-terminal peptide 1 and C-terminal peptide 2 are detected in the anterior part of the nucleus lateralis tuberis of hypothalamus, in dorsal hypothalamus, thalamus, telencephalon, optic tectum and medulla oblo
Disease: NA
Comments: NA
Taxonomy: Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: ELGTDDAVYPSLEAGTAEGGEAEGMEGVFSLQEKKDGSYKMNHFRWSGPPAS
Length: 52(145-196)
Propeptide: MLCPAWLLAVAVVGVVRGVKGQCWENPRCHDLSSENNLLECIQLCRSDLTTKSPIFPVKVHLQPPSPSDSDSPPLYLPLSLLSPSSPLYPTEQQNSVSPQAKRSYSMEHFRWGKPVGRKRRPVKVYTNGVEEESSEAFPSEMRRELGTDDAVYPSLEAGTAEGGEAEGMEGVFSLQEKKDGSYKMNHFRWSGPPASKRYGGFMKSWDERSQKPLLTLFKNVIIKDGQQKREQWGREEGEEKRALGERKYHFQG
Signal peptide: MLCPAWLLAVAVVGVVRGVKG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: [Corticotropin]: Stimulates the adrenal glands to release cortisol.; Melanocyte-stimulating hormone alpha: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; Melanocyte-stimulating hormone beta: Incr
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006253_AF2.pdb

hor006253_ESM.pdb

Mass:	644483	Formula:	C240H359N63O84S2
Absent amino acids:	CI	Common amino acids:	GE
pI:	4.08	Basic residues:	5
Polar residues:	18	Hydrophobic residues:	13
Hydrophobicity:	-77.12	Boman Index:	-9226
Half-Life:	1 hour	Half-Life Yeast:	30 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	43.27
Instability Index:	4476.35	Extinction Coefficient cystines:	8480
Absorbance 280nm:	166.27

PubMed ID: 1448114
Title: One of the two trout proopiomelanocortin messenger RNAs potentially encodes new peptides.
PubMed ID: 9299569
Title: Isolation and structural characterization of two novel peptides derived from proopiomelanocortin in the pituitary of the rainbow trout.
PubMed ID: 8977395
Title: Characterization of a novel
PubMed ID: 10022961
Title: