General Information

  • ID:  hor006252
  • Uniprot ID:  Q04617
  • Protein name:  Beta-endorphin 1
  • Gene name:  pomca
  • Organism:  Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
  • Family:  POMC family
  • Source:  animal
  • Expression:  Expressed in sexually active or inactive fish.|C-terminal peptide 1 and C-terminal peptide 2 are detected in the anterior part of the nucleus lateralis tuberis of hypothalamus, in dorsal hypothalamus, thalamus, telencephalon, optic tectum and medulla oblo
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YGGFMKSWDERSQKPLLTLFKNVIIKDGQQ
  • Length:  30
  • Propeptide:  MLCPAWLLAVAVVGVVRGVKGQCWENPRCHDLSSENNLLECIQLCRSDLTTKSPIFPVKVHLQPPSPSDSDSPPLYLPLSLLSPSSPLYPTEQQNSVSPQAKRSYSMEHFRWGKPVGRKRRPVKVYTNGVEEESSEAFPSEMRRELGTDDAVYPSLEAGTAEGGEAEGMEGVFSLQEKKDGSYKMNHFRWSGPPASKRYGGFMKSWDERSQKPLLTLFKNVIIKDGQQKREQWGREEGEEKRALGERKYHFQG
  • Signal peptide:  MLCPAWLLAVAVVGVVRGVKG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Corticotropin]: Stimulates the adrenal glands to release cortisol.; Melanocyte-stimulating hormone alpha: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; Melanocyte-stimulating hormone beta: Increases the pigmentation of skin by increasing melanin production in melanocytes.; Beta-endorphin: Endogenous orexigenic opiate.; [Met-enkephalin]: Endogenous opiate.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q04617-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006252_AF2.pdbhor006252_ESM.pdb

Physical Information

Mass: 404554 Formula: C161H252N42O45S
Absent amino acids: ACH Common amino acids: K
pI: 10.03 Basic residues: 5
Polar residues: 8 Hydrophobic residues: 9
Hydrophobicity: -66 Boman Index: -5204
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 74.67
Instability Index: 2808.33 Extinction Coefficient cystines: 6990
Absorbance 280nm: 241.03

Literature

  • PubMed ID:  1448114
  • Title:  One of the two trout proopiomelanocortin messenger RNAs potentially encodes new peptides.
  • PubMed ID:  9299569
  • Title:  Isolation and structural characterization of two novel peptides derived from proopiomelanocortin in the pituitary of the rainbow trout.
  • PubMed ID:  8977395
  • Title:  Characterization of a novel alpha-amidated decapeptide derived from proopiomelanocortin-A in the trout pituitary.
  • PubMed ID:  10022961
  • Title:  Immunohistochemical localization and biochemical characterization of two novel decapeptides derived from POMC-A in the trout hypothalamus.