General Information

  • ID:  hor006249
  • Uniprot ID:  Q02747
  • Protein name:  HMW-guanylin
  • Gene name:  GUCA2A
  • Organism:  Homo sapiens (Human)
  • Family:  Guanylin family
  • Source:  Human
  • Expression:  Highly expressed in ileum and colon. Found in plasma.
  • Disease:  Diseases associated with GUCA2A include Large Intestine Adenoma and Secretory Diarrhea.
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding; GO:0030250 guanylate cyclase activator activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
  • Length:  94(22-115)
  • Propeptide:  MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
  • Signal peptide:  MNAFLLSALCLLGAWAALAGG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  48-61; 83-91; 86-94
  • Structure ID:  AF-Q02747-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006249_AF2.pdbhor006249_ESM.pdb

Physical Information

Mass: 1200185 Formula: C455H725N119O143S6
Absent amino acids: HMW Common amino acids: EP
pI: 4.26 Basic residues: 9
Polar residues: 24 Hydrophobic residues: 30
Hydrophobicity: -33.72 Boman Index: -14001
Half-Life / Aliphatic Index: 100 hour Aliphatic Index: 82.98
Instability Index: 6346.28 Extinction Coefficient cystines: 1865
Absorbance 280nm: 20.05

Literature

  • PubMed ID:  1327879
  • Title:  Human guanylin: cDNA isolation, structure, and activity.
  • PubMed ID:  1409606
  • Title:  Precursor structure, expression, and tissue distribution of human guanylin.
  • PubMed ID:  7892222
  • Title:  Analysis of the human guanylin gene and the processing and cellular localization of the peptide.
  • PubMed ID:  16710414
  • Title:  The DNA sequence and b
  • PubMed ID:  8095028
  • Title:  
  • PubMed ID:  7947768
  • Title:  
  • PubMed ID:  12707255
  • Title: