General Information

  • ID:  hor006248
  • Uniprot ID:  Q02747
  • Protein name:  Guanylin
  • Gene name:  GUCA2A
  • Organism:  Homo sapiens (Human)
  • Family:  Guanylin family
  • Source:  Human
  • Expression:  Highly expressed in ileum and colon. Found in plasma.
  • Disease:  Diseases associated with GUCA2A include Large Intestine Adenoma and Secretory Diarrhea.
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding; GO:0030250 guanylate cyclase activator activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PGTCEICAYAACTGC
  • Length:  15(101-115)
  • Propeptide:  MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
  • Signal peptide:  MNAFLLSALCLLGAWAALAGG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  4-12; 7-15
  • Structure ID:  AF-Q02747-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006248_AF2.pdbhor006248_ESM.pdb

Physical Information

Mass: 171261 Formula: C58H91N15O21S4
Absent amino acids: DFHKLMNQRSVW Common amino acids: C
pI: 3.85 Basic residues: 0
Polar residues: 9 Hydrophobic residues: 4
Hydrophobicity: 75.33 Boman Index: 526
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 46
Instability Index: 7766.67 Extinction Coefficient cystines: 1740
Absorbance 280nm: 124.29

Literature

  • PubMed ID:  1327879
  • Title:  Human guanylin: cDNA isolation, structure, and activity.
  • PubMed ID:  1409606
  • Title:  Precursor structure, expression, and tissue distribution of human guanylin.
  • PubMed ID:  7892222
  • Title:  Analysis of the human guanylin gene and the processing and cellular localization of the peptide.
  • PubMed ID:  16710414
  • Title:  The DNA sequence and b
  • PubMed ID:  8095028
  • Title:  
  • PubMed ID:  7947768
  • Title:  
  • PubMed ID:  12707255
  • Title: