General Information

  • ID:  hor006244
  • Uniprot ID:  P91896
  • Protein name:  Bombyxin F-1 A chain
  • Gene name:  BBXF1
  • Organism:  Bombyx mori (Silk moth)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bombyx (genus), Bombycinae (subfamily), Bombycidae (family), Bombycoidea (superfamily), Obtectomera , Ditrysia , Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008083 growth factor activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  GIIDECCLQACTRDVLLSYC
  • Length:  20(76-95)
  • Propeptide:  MKLVVIVLLVISVSILVSAQELGGSRRYCGRHLAQTMAVLCWGIDEMSAEKRNSDMVYEDSGMPELLPADTRKKRGIIDECCLQACTRDVLLSYC
  • Signal peptide:  MKLVVIVLLVISVSILVSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45819
  • Structure ID:  AF-P91896-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006244_AF2.pdbhor006244_ESM.pdb

Physical Information

Mass: 255772 Formula: C92H152N24O31S4
Absent amino acids: FHKMNPW Common amino acids: C
pI: 3.88 Basic residues: 1
Polar residues: 8 Hydrophobic residues: 7
Hydrophobicity: 73.5 Boman Index: -1431
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 117
Instability Index: 9142.5 Extinction Coefficient cystines: 1740
Absorbance 280nm: 91.58

Literature

  • PubMed ID:  9401466
  • Title:  Bombyxin F1 gene: structure and expression of a new bombyxin family gene that forms a pair with bombyxin B10 gene.