General Information

  • ID:  hor006237
  • Uniprot ID:  P79897
  • Protein name:  Guanylin
  • Gene name:  GUCA2A
  • Organism:  Sus scrofa (Pig)
  • Family:  Guanylin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0030250 guanylate cyclase activator activity
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PSTCEICAYAACAGC
  • Length:  15(95-109)
  • Propeptide:  MNTFLFPTLCLLGVWAALAGGVTVKDGEFSFSLESVKKLKDLQELQKPRNPRNLDGPIIPVLCNSPKFPEELKPICQKPNAEEILERLETIAQDPSTCEICAYAACAGC
  • Signal peptide:  MNTFLFPTLCLLGVWAALAGG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  4-12; 7-15
  • Structure ID:  AF-P79897-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006237_AF2.pdbhor006237_ESM.pdb

Physical Information

Mass: 171261 Formula: C58H91N15O21S4
Absent amino acids: DFHKLMNQRVW Common amino acids: AC
pI: 3.85 Basic residues: 0
Polar residues: 8 Hydrophobic residues: 5
Hydrophobicity: 89.33 Boman Index: 530
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 52.67
Instability Index: 8009.33 Extinction Coefficient cystines: 1740
Absorbance 280nm: 124.29

Literature

  • PubMed ID:  10334930
  • Title:  Porcine guanylin and uroguanylin: cDNA sequences, deduced amino acid sequences, and biological activity of the chemically synthesized peptides.