General Information

  • ID:  hor006236
  • Uniprot ID:  P70668
  • Protein name:  Uroguanylin
  • Gene name:  Guca2b
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Guanylin family
  • Source:  animal
  • Expression:  Expressed not only in the gastrointestinal tract but also in the lung, pancreas and kidney.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0030250 guanylate cyclase activator activity
  • GO BP:  GO:0002023 reduction of food intake in response to dietary excess; GO:0007589 body fluid secretion; GO:0009749 response to glucose; GO:0019934 cGMP-mediated signaling; GO:0035264 multicellular organism growth; GO:0042593 glucose homeostasis; GO:0045776 negative regulation of blood pressure; GO:0060612 adipose tissue development; GO:0070294 renal sodium ion absorption; GO:0097009 energy homeostasis
  • GO CC:  GO:0001750 photoreceptor outer segment; GO:0005576 extracellular region

Sequence Information

  • Sequence:  TDECELCINVACTGC
  • Length:  15
  • Propeptide:  MSGSQLWAAVLLLLVLQSAQGVYIKYHGFQVQLESVKKLNELEEKQMSDPQQQKSGLLPDVCYNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC
  • Signal peptide:  MSGSQLWAAVLLLLVLQSAQG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  4-12; 7-15
  • Structure ID:  AF-P70668-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006236_AF2.pdbhor006236_ESM.pdb

Physical Information

Mass: 182371 Formula: C60H100N16O25S4
Absent amino acids: FHKMPQRSWY Common amino acids: C
pI: 3.42 Basic residues: 0
Polar residues: 8 Hydrophobic residues: 4
Hydrophobicity: 56.67 Boman Index: -1237
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 78
Instability Index: 8399.33 Extinction Coefficient cystines: 250
Absorbance 280nm: 17.86

Literature

  • PubMed ID:  9094754
  • Title:  Purification, cDNA sequence, and tissue distribution of rat uroguanylin.
  • PubMed ID:  8977100
  • Title:  Uroguanylin gene expression in the alimentary tract and extra-gastrointestinal tissues.
  • PubMed ID:  9176203
  • Title:  Upregulation of rat intestinal uroguanylin mRNA by dietary zinc restriction.