General Information

  • ID:  hor006225
  • Uniprot ID:  P53366
  • Protein name:  Adrenomedullin
  • Gene name:  ADM
  • Organism:  Sus scrofa (Pig)
  • Family:  Adrenomedullin family
  • Source:  animal
  • Expression:  Highly expressed in adrenal glands, lung and kidney.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031700 adrenomedullin receptor binding
  • GO BP:  GO:0001570 vasculogenesis; GO:0001843 neural tube closure; GO:0002031 G protein-coupled receptor internalization; GO:0003073 regulation of systemic arterial blood pressure; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007507 heart development; GO:0008283 cell population proliferation; GO:0008284 positive regulation of cell population proliferation; GO:0010460 positive regulation of heart rate; GO:0031623 receptor internalization; GO:0035809 regulation of urine volume; GO:0043116 negative regulation of vascular permeability; GO:0045766 positive regulation of angiogenesis; GO:0045906 negative regulation of vasoconstriction; GO:0048589 developmental growth; GO:0060670 branching involved in labyrinthine layer morphogenesis; GO:0060712 spongiotrophoblast layer development; GO:0097084 vascular associated smooth muscle cell development; GO:1990410 adrenomedullin receptor signaling pathway; GO:2001214 positive regulation of vasculogenesis
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm

Sequence Information

  • Sequence:  YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY
  • Length:  52
  • Propeptide:  MKLVPVALMYLGSLAFLGADTARLDVAAEFRKKWNKWALSRGKRELRLSSSYPTGIADLKAGPAQTVIRPQDVKGSSRSPQASIPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGYGRRRRRSLPEASLGRTLRSQEPQAHGAPASPAHQVLATLFRI
  • Signal peptide:  MKLVPVALMYLGSLAFLGADT
  • Modification:  T52 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  AM and PAMP are potent hypotensive and vasodilatator agents.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  16-21
  • Structure ID:  AF-P53366-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006225_AF2.pdbhor006225_ESM.pdb

Physical Information

Mass: 688460 Formula: C262H404N78O77S3
Absent amino acids: EW Common amino acids: QG
pI: 10.07 Basic residues: 9
Polar residues: 19 Hydrophobic residues: 12
Hydrophobicity: -82.69 Boman Index: -12804
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 45
Instability Index: 4422.12 Extinction Coefficient cystines: 4595
Absorbance 280nm: 90.1

Literature

  • PubMed ID:  8043068
  • Title:  Complete amino acid sequence of porcine adrenomedullin and cloning of cDNA encoding its precursor.
  • PubMed ID:  8076689
  • Title:  Identification and hypotensive activity of proadrenomedullin N-terminal 20 peptide (PAMP).