General Information

  • ID:  hor006223
  • Uniprot ID:  P51456
  • Protein name:  Relaxin-like protein SQ10 B chain
  • Gene name:  NA
  • Organism:  Oryctolagus cuniculus (Rabbit)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  During squamous cell differentiation. Repressed by retinoic acid.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Oryctolagus (genus), Leporidae (family), Lagomorpha (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RVTYEWMMENVKICRNDFVRTAIEVCGHVHLE
  • Length:  32(21-52)
  • Propeptide:  MPALLFYLLGFCLLQGQVTGRVTYEWMMENVKICRNDFVRTAIEVCGHVHLERESPSPENPFLSSGPAAETVPSSIKKDAENANTMLESIPNLPQELTATLFEKQPSKLYLQYLPTLKKSNVSFEEFKKIIQNIQRGVQGSSASESNTFSRKKRQFSESLPEECCKYGCPRYYLLMYC
  • Signal peptide:  MPALLFYLLGFCLLQGQVTG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RXFP2, RXFP1
  • Target Unid:   G1SDZ8, A0A0M3SGA3
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P51456-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006223_AF2.pdbhor006223_ESM.pdb

Physical Information

Mass: 443263 Formula: C169H265N49O48S4
Absent amino acids: PQS Common amino acids: V
pI: 6.49 Basic residues: 6
Polar residues: 8 Hydrophobic residues: 11
Hydrophobicity: -15.94 Boman Index: -6387
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 85
Instability Index: 1815.94 Extinction Coefficient cystines: 7115
Absorbance 280nm: 229.52

Literature

  • PubMed ID:  1339318
  • Title:  Expression of a preprorelaxin-like gene during squamous differentiation of rabbit tracheobronchial epithelial cells and its suppression by retinoic acid.