HORDB

ID: hor006220
Uniprot ID: P51454
Protein name: Relaxin A chain
Gene name: RNL1
Organism: Pan troglodytes (Chimpanzee)
Family: Insulin family
Source: Animal
Expression: Expressed in the corpus luteum of pregnancy but not in the placenta.
Disease: NA
Comments: NA
Taxonomy: Pan (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: QPYVALFEKCCLIGCTKRSLANYC
Length: 24(143-166)
Propeptide: SRAVADSWMDEVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPEPQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRQPYVALFEKCCLIGCTKRSLANYC
Signal peptide: SRAVA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix.
Mechanism: NA
Cross BBB: NA
Target: RXFP2, RXFP1
Target Unid: H2Q7E1, H2R4E6
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006220_AF2.pdb

hor006220_ESM.pdb

Mass:	313471	Formula:	C120H191N31O33S4
Absent amino acids:	DHMW	Common amino acids:	C
pI:	8.33	Basic residues:	3
Polar residues:	10	Hydrophobic residues:	8
Hydrophobicity:	31.67	Boman Index:	-1488
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	85.42
Instability Index:	7110.83	Extinction Coefficient cystines:	3230
Absorbance 280nm:	140.43