General Information

  • ID:  hor006219
  • Uniprot ID:  P51453
  • Protein name:  Relaxin B chain
  • Gene name:  RLN
  • Organism:  Cavia porcellus (Guinea pig)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  Expressed in the endometrium during pregnancy and in mammary gland during lactation.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GFLDKVIKVCGRDLVRIKIDICGKILLGDMTTG
  • Length:  33(1-33)
  • Propeptide:  GFLDKVIKVCGRDLVRIKIDICGKILLGDMTTGQEKQRILGSGQSAEIMPSSINKEVDSLNMLESIANLPEELRAMLPEKQPSSPQLQQYVPALKNSNVAVKELNKIIRGRQEEAEDNSHSLLKDFNLNIYSPKKRQLDMTVSEKCCQVGCTRRFIANSC
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. It bears mature young, and allows separation of the pelvic bones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P51453-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006219_AF2.pdbhor006219_ESM.pdb

Physical Information

Mass: 416240 Formula: C159H277N43O44S3
Absent amino acids: AEHNPQSWY Common amino acids: GI
pI: 8.81 Basic residues: 6
Polar residues: 9 Hydrophobic residues: 13
Hydrophobicity: 54.55 Boman Index: -2307
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 132.73
Instability Index: -849.39 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.91

Literature

  • PubMed ID:  1537282
  • Title:  The complementary deoxyribonucleic acid sequence of guinea pig endometrial prorelaxin.