General Information

  • ID:  hor006214
  • Uniprot ID:  P47932
  • Protein name:  Relaxin B chain
  • Gene name:  Rln1
  • Organism:  Mus musculus (Mouse)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway; GO:0007283 spermatogenesis; GO:0010749 regulation of nitric oxide mediated signal transduction; GO:0042127 regulation of cell population proliferation; GO:0042981 regulation of apoptotic process; GO:0043066 negative regulation of apoptotic process; GO:0048589 developmental growth; GO:0060443 mammary gland morphogenesis; GO:0060618 nipple development; GO:0060736 prostate gland growth
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RVSEEWMDGFIRMCGREYARELIKICGASVGRLAL
  • Length:  35(23-57)
  • Propeptide:  MSSRFLLQLLGFWLLLSQPCRTRVSEEWMDGFIRMCGREYARELIKICGASVGRLALSQEEPALLARQATEVVPSFINKDAEPFDTTLKCLPNLSEELKAVLSEAQASLPELQHAPVLSDSVVSLEGFKKTLHDRLGEAEDGSPPGLKYLQSDTHSRKKRESGGLMSQQCCHVGCSRRSIAKLYC
  • Signal peptide:  MSSRFLLQLLGFWLLLSQPCRT
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Rxfp1, Rxfp2
  • Target Unid:  Q6R6I7, Q91ZZ5
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P47932-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006214_AF2.pdbhor006214_ESM.pdb

Physical Information

Mass: 462337 Formula: C174H284N52O49S4
Absent amino acids: HNPQT Common amino acids: R
pI: 8.22 Basic residues: 6
Polar residues: 9 Hydrophobic residues: 13
Hydrophobicity: 2.86 Boman Index: -6369
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 92
Instability Index: 2406.57 Extinction Coefficient cystines: 7115
Absorbance 280nm: 209.26

Literature

  • PubMed ID:  8452637
  • Title:  The mouse relaxin gene: nucleotide sequence and expression.
  • PubMed ID:  8216305
  • Title:  Mouse relaxin: synthesis and biological activity of the first relaxin with an unusual crosslinking pattern.