General Information

  • ID:  hor006192
  • Uniprot ID:  P33680
  • Protein name:  Guanylin
  • Gene name:  Guca2a
  • Organism:  Mus musculus (Mouse)
  • Family:  Guanylin family
  • Source:  animal
  • Expression:  Localized in both crypts and villi in the small intestine and to superficial epithelial cells in the colon.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0030250 guanylate cyclase activator activity
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PNTCEICAYAACTGC
  • Length:  15
  • Propeptide:  MNACVLSVLCLLGALAVLVEGVTVQDGDLSFPLESVKKLKGLREVQEPRLVSHKKFAPRLLQPVAPQLCSSHSALPEALRPVCEKPNAEEILQRLEAIAQDPNTCEICAYAACTGC
  • Signal peptide:  MNACVLSVLCLLGALAVLVEGVT
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  4-12; 7-15
  • Structure ID:  AF-P33680-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006192_AF2.pdbhor006192_ESM.pdb

Physical Information

Mass: 176966 Formula: C60H94N16O22S4
Absent amino acids: DFHKLMQRSVW Common amino acids: C
pI: 3.85 Basic residues: 0
Polar residues: 9 Hydrophobic residues: 4
Hydrophobicity: 54.67 Boman Index: -232
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 46
Instability Index: 7766.67 Extinction Coefficient cystines: 1740
Absorbance 280nm: 124.29

Literature

  • PubMed ID:  1409606
  • Title:  Precursor structure, expression, and tissue distribution of human guanylin.
  • PubMed ID:  7713512
  • Title:  Genomic sequence of the murine guanylin gene.
  • PubMed ID:  16141072
  • Title:  The transcriptional landscape of the mammalian genome.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).