General Information

  • ID:  hor006129
  • Uniprot ID:  P20968
  • Protein name:  C-type natriuretic peptide 1
  • Gene name:  NA
  • Organism:  Lithobates catesbeianus (American bullfrog) (Rana catesbeiana)
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Lithobates (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0003418 growth plate cartilage chondrocyte differentiation; GO:0003419 growth plate cartilage chondrocyte proliferation; GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GYSRGCFGVKLDRIGAFSGLGC
  • Length:  22(108-129)
  • Propeptide:  MSYKRGTCLGFIMLLMVSHHHTKGKPLSSLQNLSRLLEDNFERSFGSDEADQQLVPTDSLDQLDPELQWNKNRLEQGDSPHVNEMTLQQLLNDPVGTSRRYRQRNKKGYSRGCFGVKLDRIGAFSGLGC
  • Signal peptide:  MSYKRGTCLGFIMLLMVSHHHTKG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone which plays a role in endochondral ossification through regulation of cartilaginous growth plate chondrocytes proliferation and differentiation. May also be vasoactive and natriuretic. May be important for freshwater adaptation (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45830
  • Structure ID:  AF-P20968-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006129_AF2.pdbhor006129_ESM.pdb

Physical Information

Mass: 263838 Formula: C99H155N29O28S2
Absent amino acids: EHMNPQTW Common amino acids: G
pI: 8.8 Basic residues: 3
Polar residues: 11 Hydrophobic residues: 7
Hydrophobicity: 31.82 Boman Index: -1628
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 70.91
Instability Index: -187.27 Extinction Coefficient cystines: 1615
Absorbance 280nm: 76.9

Literature

  • PubMed ID:  8175740
  • Title:  Cloning and characterization of a novel natriuretic peptide in frog (Rana catesbeiana).
  • PubMed ID:  2148082
  • Title:  Isolation and sequence determination of frog C-type natriuretic peptide.