HORDB

ID: hor006129
Uniprot ID: P20968
Protein name: C-type natriuretic peptide 1
Gene name: NA
Organism: Lithobates catesbeianus (American bullfrog) (Rana catesbeiana)
Family: Natriuretic peptide family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Lithobates (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0003418 growth plate cartilage chondrocyte differentiation; GO:0003419 growth plate cartilage chondrocyte proliferation; GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region

Sequence: GYSRGCFGVKLDRIGAFSGLGC
Length: 22(108-129)
Propeptide: MSYKRGTCLGFIMLLMVSHHHTKGKPLSSLQNLSRLLEDNFERSFGSDEADQQLVPTDSLDQLDPELQWNKNRLEQGDSPHVNEMTLQQLLNDPVGTSRRYRQRNKKGYSRGCFGVKLDRIGAFSGLGC
Signal peptide: MSYKRGTCLGFIMLLMVSHHHTKG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Hormone which plays a role in endochondral ossification through regulation of cartilaginous growth plate chondrocytes proliferation and differentiation. May also be vasoactive and natriuretic. May be important for freshwater adaptation (By similarity).
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006129_AF2.pdb

hor006129_ESM.pdb

Mass:	263838	Formula:	C99H155N29O28S2
Absent amino acids:	EHMNPQTW	Common amino acids:	G
pI:	8.8	Basic residues:	3
Polar residues:	11	Hydrophobic residues:	7
Hydrophobicity:	31.82	Boman Index:	-1628
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	70.91
Instability Index:	-187.27	Extinction Coefficient cystines:	1615
Absorbance 280nm:	76.9

PubMed ID: 8175740
Title: Cloning and characterization of a novel natriuretic peptide in frog (Rana catesbeiana).
PubMed ID: 2148082
Title: Isolation and sequence determination of frog C-type natriuretic peptide.