General Information

  • ID:  hor006127
  • Uniprot ID:  P19884
  • Protein name:  Relaxin B chain
  • Gene name:  RLN
  • Organism:  Macaca mulatta (Rhesus macaque)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AKWMDDVIKACGRELVRAQIAICGKSTLG
  • Length:  29(25-53)
  • Propeptide:  MPRLFLFHLLGVCLLLNQFSRAVAAKWMDDVIKACGRELVRAQIAICGKSTLGKRSLNQEDAPLKPRPAAEIVPSLINQDTETINMMSEFVANLPQELKLTLSERQPALSELQQHVPVLKDSNLSFEEFKKIIRKRQSEATDSSPSELRSLGLDTHSRRKRQLYMTLSNKCCHIGCTKKSLAKFC
  • Signal peptide:  MPRLFLFHLLGVCLLLNQFSRAVA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P19884-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006127_AF2.pdbhor006127_ESM.pdb

Physical Information

Mass: 363339 Formula: C135H230N40O39S3
Absent amino acids: FHNPY Common amino acids: A
pI: 8.81 Basic residues: 5
Polar residues: 7 Hydrophobic residues: 12
Hydrophobicity: 18.28 Boman Index: -3227
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 101.03
Instability Index: 2711.72 Extinction Coefficient cystines: 5625
Absorbance 280nm: 200.89

Literature

  • PubMed ID:  2590381
  • Title:  Structure of rhesus monkey relaxin predicted by analysis of the single-copy rhesus monkey relaxin gene.