General Information

  • ID:  hor006107
  • Uniprot ID:  P04808
  • Protein name:  Relaxin B chain
  • Gene name:  RLN1
  • Organism:  Homo sapiens (Human)
  • Family:  Insulin family
  • Source:  Human
  • Expression:  Prostate. Not expressed in placenta, decidua or ovary.
  • Disease:  Diseases associated with RLN1 include Spermatogenic Failure 8 and Extragonadal Germ Cell Cancer.
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0007165 signal transduction; GO:0007565 female pregnancy
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VAAKWKDDVIKLCGRELVRAQIAICGMSTWS
  • Length:  31(23-53)
  • Propeptide:  MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC
  • Signal peptide:  MPRLFLFHLLEFCLLLNQFSRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RXFP2, RXFP1
  • Target Unid:   Q8WXD0, Q9HBX9
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P04808-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006107_AF2.pdbhor006107_ESM.pdb

Physical Information

Mass: 398443 Formula: C152H251N43O42S3
Absent amino acids: FHNPY Common amino acids: A
pI: 8.81 Basic residues: 5
Polar residues: 7 Hydrophobic residues: 14
Hydrophobicity: 26.45 Boman Index: -3024
Half-Life / Aliphatic Index: 100 hour Aliphatic Index: 103.87
Instability Index: 1352.58 Extinction Coefficient cystines: 11125
Absorbance 280nm: 370.83

Literature

  • PubMed ID:  6548702
  • Title:  Relaxin gene expression in human ovaries and the predicted structure of a human preprorelaxin by analysis of cDNA clones.
  • PubMed ID:  6298628
  • Title:  Structure of a genomic clone encoding biologically active human relaxin.
  • PubMed ID:  15164053
  • Title:  DNA sequence and analysis of human chromosome 9.
  • PubMed ID:  15489334
  • Title:  The stat
  • PubMed ID:  8735594
  • Title:  
  • PubMed ID:  10601981
  • Title: